BLASTX nr result
ID: Cinnamomum24_contig00009782
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00009782 (404 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KCW56103.1| hypothetical protein EUGRSUZ_I01857 [Eucalyptus g... 67 5e-09 ref|XP_002516372.1| conserved hypothetical protein [Ricinus comm... 60 6e-07 >gb|KCW56103.1| hypothetical protein EUGRSUZ_I01857 [Eucalyptus grandis] Length = 143 Score = 67.0 bits (162), Expect = 5e-09 Identities = 43/77 (55%), Positives = 49/77 (63%), Gaps = 3/77 (3%) Frame = +2 Query: 29 LLHELVSQARNEPCLRSDFSLLVLLASG--EASSP*AFWYGRNTTLKADHYIGAIAKPSR 202 +LHELVSQ RNEPCL+S + LL + E + + R YIGAIAKPSR Sbjct: 37 VLHELVSQVRNEPCLQSRATSACLLLAKLLELDNKHSSIVKRLLIRPTTTYIGAIAKPSR 96 Query: 203 QKASSPY-SNSKRPTYS 250 KASSPY SNSKRPTYS Sbjct: 97 IKASSPYSSNSKRPTYS 113 >ref|XP_002516372.1| conserved hypothetical protein [Ricinus communis] gi|223544470|gb|EEF45989.1| conserved hypothetical protein [Ricinus communis] Length = 103 Score = 60.1 bits (144), Expect = 6e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +2 Query: 164 ADHYIGAIAKPSRQKASSPYSNSKRPTYSP 253 +DHYIGAIAKPSR KAS+PYSNSKRPTYSP Sbjct: 31 SDHYIGAIAKPSRIKASNPYSNSKRPTYSP 60