BLASTX nr result
ID: Cinnamomum24_contig00006255
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00006255 (396 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532811.1| Chitinase 1 precursor, putative [Ricinus com... 56 8e-06 >ref|XP_002532811.1| Chitinase 1 precursor, putative [Ricinus communis] gi|223527431|gb|EEF29568.1| Chitinase 1 precursor, putative [Ricinus communis] Length = 305 Score = 56.2 bits (134), Expect = 8e-06 Identities = 33/54 (61%), Positives = 40/54 (74%), Gaps = 5/54 (9%) Frame = +3 Query: 249 MDFTKLISLLILVQM----HTLLSTQAA-TNSKLFREYIGAEFNNVKFSSVPIN 395 M+ +KL+ L+++Q HT STQAA NS LFREYIGAEFNNVKF+ VPIN Sbjct: 1 MELSKLLITLLILQAIFPSHT--STQAAPANSDLFREYIGAEFNNVKFTDVPIN 52