BLASTX nr result
ID: Cinnamomum24_contig00005749
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00005749 (496 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB09792.1| hypothetical protein B456_001G166500 [Gossypium r... 100 3e-19 emb|CAN71466.1| hypothetical protein VITISV_038987 [Vitis vinifera] 70 5e-10 ref|XP_007137486.1| hypothetical protein PHAVU_009G130900g [Phas... 69 9e-10 emb|CDY67014.1| BnaUnng01810D, partial [Brassica napus] 66 1e-08 emb|CDY67692.1| BnaUnng02390D [Brassica napus] 66 1e-08 >gb|KJB09792.1| hypothetical protein B456_001G166500 [Gossypium raimondii] Length = 61 Score = 100 bits (250), Expect = 3e-19 Identities = 52/61 (85%), Positives = 54/61 (88%) Frame = -3 Query: 305 MTPADLTLPTPGANPLAVLPPRRRTGARVEPWISGVTAVERNKILRPRNIGAYGTGNSAK 126 MTPAD TL TPGANPL+VLPPRRRT ARVEP+ISGVTAVERNKILR RNI A GT NSAK Sbjct: 1 MTPADFTLSTPGANPLSVLPPRRRTRARVEPFISGVTAVERNKILRSRNIRAGGTVNSAK 60 Query: 125 I 123 I Sbjct: 61 I 61 >emb|CAN71466.1| hypothetical protein VITISV_038987 [Vitis vinifera] Length = 325 Score = 70.1 bits (170), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -2 Query: 462 FELPFIRFAGAAQHIAGSQRARTTCLTLRSEGP 364 FELPFIRFAGAAQHIAGSQRARTTCLTLRSEGP Sbjct: 293 FELPFIRFAGAAQHIAGSQRARTTCLTLRSEGP 325 >ref|XP_007137486.1| hypothetical protein PHAVU_009G130900g [Phaseolus vulgaris] gi|561010573|gb|ESW09480.1| hypothetical protein PHAVU_009G130900g [Phaseolus vulgaris] Length = 48 Score = 69.3 bits (168), Expect = 9e-10 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = -3 Query: 305 MTPADLTLPTPGANPLAVLPPRRRTGARVEPWISGVTAVERNK 177 MTPADL L TPGAN L+VLPP RRTGARVEP++ GVTAVER K Sbjct: 1 MTPADLNLSTPGANLLSVLPPCRRTGARVEPFLFGVTAVERKK 43 >emb|CDY67014.1| BnaUnng01810D, partial [Brassica napus] Length = 451 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 459 ELPFIRFAGAAQHIAGSQRARTTCLTLRSEGP 364 ELPFIRFAGAAQHIAGSQRA TTCLTLRSEGP Sbjct: 216 ELPFIRFAGAAQHIAGSQRAHTTCLTLRSEGP 247 >emb|CDY67692.1| BnaUnng02390D [Brassica napus] Length = 228 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 459 ELPFIRFAGAAQHIAGSQRARTTCLTLRSEGP 364 ELPFIRFAGAAQHIAGSQRA TTCLTLRSEGP Sbjct: 197 ELPFIRFAGAAQHIAGSQRAHTTCLTLRSEGP 228