BLASTX nr result
ID: Cinnamomum24_contig00005740
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00005740 (779 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS59999.1| hypothetical protein M569_14806, partial [Genlise... 92 3e-16 >gb|EPS59999.1| hypothetical protein M569_14806, partial [Genlisea aurea] Length = 74 Score = 92.4 bits (228), Expect = 3e-16 Identities = 45/61 (73%), Positives = 52/61 (85%) Frame = -2 Query: 493 QVCRVVGITAIQRVVRLIVHARSVRRKGSVALSSPSPHGGRGALPSEGGSPSDLLFLAGG 314 +V R+ ITAI RV+R I+H R+VRRKG V ++PSPHGGRGALPSEGGSPSDLLFLAGG Sbjct: 10 KVFRLSTITAISRVIRPIIHVRAVRRKGCVIGTNPSPHGGRGALPSEGGSPSDLLFLAGG 69 Query: 313 G 311 G Sbjct: 70 G 70