BLASTX nr result
ID: Cinnamomum24_contig00004993
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00004993 (543 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN06373.1| Thylakoid membrane phosphoprotein 14 kDa, chlorop... 94 4e-17 ref|XP_006582841.1| PREDICTED: uncharacterized protein LOC100306... 94 4e-17 ref|XP_003548086.1| PREDICTED: protein CURVATURE THYLAKOID 1B, c... 94 4e-17 ref|XP_007135329.1| hypothetical protein PHAVU_010G120100g [Phas... 92 1e-16 ref|XP_006444716.1| hypothetical protein CICLE_v10022571mg [Citr... 92 1e-16 ref|XP_006444714.1| hypothetical protein CICLE_v10022571mg [Citr... 92 1e-16 ref|XP_009142595.1| PREDICTED: protein CURVATURE THYLAKOID 1B, c... 91 2e-16 emb|CDY41562.1| BnaC04g00600D [Brassica napus] 91 2e-16 emb|CDX80050.1| BnaA05g01060D [Brassica napus] 91 2e-16 ref|XP_010688395.1| PREDICTED: protein CURVATURE THYLAKOID 1B, c... 91 3e-16 ref|XP_011094131.1| PREDICTED: protein CURVATURE THYLAKOID 1B, c... 91 4e-16 ref|XP_008244209.1| PREDICTED: protein CURVATURE THYLAKOID 1B, c... 91 4e-16 ref|XP_010523840.1| PREDICTED: protein CURVATURE THYLAKOID 1B, c... 90 7e-16 ref|XP_012843914.1| PREDICTED: protein CURVATURE THYLAKOID 1B, c... 89 9e-16 ref|XP_006295091.1| hypothetical protein CARUB_v10024165mg [Caps... 89 9e-16 ref|XP_010241049.1| PREDICTED: protein CURVATURE THYLAKOID 1B, c... 89 1e-15 gb|KFK37449.1| hypothetical protein AALP_AA4G258300 [Arabis alpina] 89 1e-15 ref|XP_008797634.1| PREDICTED: protein CURVATURE THYLAKOID 1B, c... 89 1e-15 ref|XP_006397874.1| hypothetical protein EUTSA_v10001663mg [Eutr... 89 1e-15 ref|XP_007220420.1| hypothetical protein PRUPE_ppa012395mg [Prun... 89 1e-15 >gb|KHN06373.1| Thylakoid membrane phosphoprotein 14 kDa, chloroplastic [Glycine soja] Length = 168 Score = 94.0 bits (232), Expect = 4e-17 Identities = 40/50 (80%), Positives = 49/50 (98%) Frame = -1 Query: 543 DRLPLIPGVLELVGIGYTGWFVYQNLVFQPDREALLRKVTDTYNDIIGSN 394 DRLPLIPG+LE+VGIGYTGWFVY+N+VF+PDREAL+RKV +TYN+I+GSN Sbjct: 119 DRLPLIPGILEIVGIGYTGWFVYKNIVFKPDREALVRKVKETYNEILGSN 168 >ref|XP_006582841.1| PREDICTED: uncharacterized protein LOC100306403 isoform X1 [Glycine max] Length = 168 Score = 94.0 bits (232), Expect = 4e-17 Identities = 40/50 (80%), Positives = 49/50 (98%) Frame = -1 Query: 543 DRLPLIPGVLELVGIGYTGWFVYQNLVFQPDREALLRKVTDTYNDIIGSN 394 DRLPLIPG+LE+VGIGYTGWFVY+N+VF+PDREAL+RKV +TYN+I+GSN Sbjct: 119 DRLPLIPGILEIVGIGYTGWFVYKNIVFKPDREALVRKVKETYNEILGSN 168 >ref|XP_003548086.1| PREDICTED: protein CURVATURE THYLAKOID 1B, chloroplastic-like [Glycine max] gi|734361930|gb|KHN15873.1| Thylakoid membrane phosphoprotein 14 kDa, chloroplastic [Glycine soja] Length = 168 Score = 94.0 bits (232), Expect = 4e-17 Identities = 40/50 (80%), Positives = 49/50 (98%) Frame = -1 Query: 543 DRLPLIPGVLELVGIGYTGWFVYQNLVFQPDREALLRKVTDTYNDIIGSN 394 DRLPLIPG+LE+VGIGYTGWFVY+N+VF+PDREAL+RKV +TYN+I+GSN Sbjct: 119 DRLPLIPGILEIVGIGYTGWFVYKNIVFKPDREALVRKVKETYNEILGSN 168 >ref|XP_007135329.1| hypothetical protein PHAVU_010G120100g [Phaseolus vulgaris] gi|561008374|gb|ESW07323.1| hypothetical protein PHAVU_010G120100g [Phaseolus vulgaris] Length = 168 Score = 92.4 bits (228), Expect = 1e-16 Identities = 39/50 (78%), Positives = 49/50 (98%) Frame = -1 Query: 543 DRLPLIPGVLELVGIGYTGWFVYQNLVFQPDREALLRKVTDTYNDIIGSN 394 DRLPLIPG+LE+VGIGYTGWFVY+N+VF+PDREAL+++V DTYN+I+GSN Sbjct: 119 DRLPLIPGILEIVGIGYTGWFVYKNIVFKPDREALVQQVKDTYNEILGSN 168 >ref|XP_006444716.1| hypothetical protein CICLE_v10022571mg [Citrus clementina] gi|568876648|ref|XP_006491387.1| PREDICTED: protein CURVATURE THYLAKOID 1B, chloroplastic-like [Citrus sinensis] gi|557546978|gb|ESR57956.1| hypothetical protein CICLE_v10022571mg [Citrus clementina] gi|641867945|gb|KDO86629.1| hypothetical protein CISIN_1g030898mg [Citrus sinensis] Length = 169 Score = 92.0 bits (227), Expect = 1e-16 Identities = 40/50 (80%), Positives = 47/50 (94%) Frame = -1 Query: 543 DRLPLIPGVLELVGIGYTGWFVYQNLVFQPDREALLRKVTDTYNDIIGSN 394 DRLPL+PGVLELVGIGYTGWF Y+NLVF+PDREAL++K+ DTY DIIGS+ Sbjct: 120 DRLPLVPGVLELVGIGYTGWFAYKNLVFKPDREALIQKIKDTYKDIIGSS 169 >ref|XP_006444714.1| hypothetical protein CICLE_v10022571mg [Citrus clementina] gi|557546976|gb|ESR57954.1| hypothetical protein CICLE_v10022571mg [Citrus clementina] Length = 140 Score = 92.0 bits (227), Expect = 1e-16 Identities = 40/50 (80%), Positives = 47/50 (94%) Frame = -1 Query: 543 DRLPLIPGVLELVGIGYTGWFVYQNLVFQPDREALLRKVTDTYNDIIGSN 394 DRLPL+PGVLELVGIGYTGWF Y+NLVF+PDREAL++K+ DTY DIIGS+ Sbjct: 91 DRLPLVPGVLELVGIGYTGWFAYKNLVFKPDREALIQKIKDTYKDIIGSS 140 >ref|XP_009142595.1| PREDICTED: protein CURVATURE THYLAKOID 1B, chloroplastic [Brassica rapa] Length = 183 Score = 91.3 bits (225), Expect = 2e-16 Identities = 39/50 (78%), Positives = 46/50 (92%) Frame = -1 Query: 543 DRLPLIPGVLELVGIGYTGWFVYQNLVFQPDREALLRKVTDTYNDIIGSN 394 DRLPL+PGVLE+VGIGYTGWF Y+NL+F+PDRE L++KV DTY DIIGSN Sbjct: 134 DRLPLVPGVLEVVGIGYTGWFAYKNLIFKPDRETLIQKVKDTYRDIIGSN 183 >emb|CDY41562.1| BnaC04g00600D [Brassica napus] Length = 183 Score = 91.3 bits (225), Expect = 2e-16 Identities = 40/50 (80%), Positives = 46/50 (92%) Frame = -1 Query: 543 DRLPLIPGVLELVGIGYTGWFVYQNLVFQPDREALLRKVTDTYNDIIGSN 394 DRLPL+PGVLE+VGIGYTGWF Y+NLVF+PDRE+L +KV DTY DIIGSN Sbjct: 134 DRLPLVPGVLEVVGIGYTGWFAYKNLVFKPDRESLFQKVKDTYRDIIGSN 183 >emb|CDX80050.1| BnaA05g01060D [Brassica napus] Length = 183 Score = 91.3 bits (225), Expect = 2e-16 Identities = 39/50 (78%), Positives = 46/50 (92%) Frame = -1 Query: 543 DRLPLIPGVLELVGIGYTGWFVYQNLVFQPDREALLRKVTDTYNDIIGSN 394 DRLPL+PGVLE+VGIGYTGWF Y+NL+F+PDRE L++KV DTY DIIGSN Sbjct: 134 DRLPLVPGVLEVVGIGYTGWFAYKNLIFKPDRETLIQKVKDTYRDIIGSN 183 >ref|XP_010688395.1| PREDICTED: protein CURVATURE THYLAKOID 1B, chloroplastic [Beta vulgaris subsp. vulgaris] gi|870869457|gb|KMT20202.1| hypothetical protein BVRB_1g002080 [Beta vulgaris subsp. vulgaris] Length = 193 Score = 90.9 bits (224), Expect = 3e-16 Identities = 39/50 (78%), Positives = 47/50 (94%) Frame = -1 Query: 543 DRLPLIPGVLELVGIGYTGWFVYQNLVFQPDREALLRKVTDTYNDIIGSN 394 DRLPL+PGVLELVGIGYTGWF Y+NLVF+P+REAL++K+ DTY DIIGS+ Sbjct: 144 DRLPLVPGVLELVGIGYTGWFAYRNLVFKPEREALIKKIKDTYKDIIGSS 193 >ref|XP_011094131.1| PREDICTED: protein CURVATURE THYLAKOID 1B, chloroplastic [Sesamum indicum] Length = 170 Score = 90.5 bits (223), Expect = 4e-16 Identities = 38/50 (76%), Positives = 47/50 (94%) Frame = -1 Query: 543 DRLPLIPGVLELVGIGYTGWFVYQNLVFQPDREALLRKVTDTYNDIIGSN 394 DRLPL+PGV+E+VGIGYTGWF Y+NLVF+PDREAL++K+ TYNDIIGS+ Sbjct: 121 DRLPLVPGVMEIVGIGYTGWFAYRNLVFKPDREALIQKIKSTYNDIIGSS 170 >ref|XP_008244209.1| PREDICTED: protein CURVATURE THYLAKOID 1B, chloroplastic [Prunus mume] Length = 171 Score = 90.5 bits (223), Expect = 4e-16 Identities = 40/49 (81%), Positives = 45/49 (91%) Frame = -1 Query: 543 DRLPLIPGVLELVGIGYTGWFVYQNLVFQPDREALLRKVTDTYNDIIGS 397 DRLPL+PGVLELVGIGYTGWF Y+NLVF+PDREAL +K+ DTY DIIGS Sbjct: 122 DRLPLVPGVLELVGIGYTGWFAYKNLVFKPDREALTQKIKDTYKDIIGS 170 >ref|XP_010523840.1| PREDICTED: protein CURVATURE THYLAKOID 1B, chloroplastic-like [Tarenaya hassleriana] Length = 173 Score = 89.7 bits (221), Expect = 7e-16 Identities = 39/49 (79%), Positives = 45/49 (91%) Frame = -1 Query: 543 DRLPLIPGVLELVGIGYTGWFVYQNLVFQPDREALLRKVTDTYNDIIGS 397 DRLPL+PGVLELVGIGYTGWF YQNLV++PDREA L+K+ DTY +IIGS Sbjct: 124 DRLPLVPGVLELVGIGYTGWFTYQNLVYKPDREAFLQKIKDTYKEIIGS 172 >ref|XP_012843914.1| PREDICTED: protein CURVATURE THYLAKOID 1B, chloroplastic [Erythranthe guttatus] gi|604321724|gb|EYU32300.1| hypothetical protein MIMGU_mgv1a015066mg [Erythranthe guttata] Length = 169 Score = 89.4 bits (220), Expect = 9e-16 Identities = 39/50 (78%), Positives = 46/50 (92%) Frame = -1 Query: 543 DRLPLIPGVLELVGIGYTGWFVYQNLVFQPDREALLRKVTDTYNDIIGSN 394 DRLPLIPG+LELVGIGYTGWF Y+NLV PDR+AL++K+ DTYNDIIGS+ Sbjct: 120 DRLPLIPGILELVGIGYTGWFAYRNLVSTPDRQALIQKIKDTYNDIIGSS 169 >ref|XP_006295091.1| hypothetical protein CARUB_v10024165mg [Capsella rubella] gi|482563799|gb|EOA27989.1| hypothetical protein CARUB_v10024165mg [Capsella rubella] Length = 175 Score = 89.4 bits (220), Expect = 9e-16 Identities = 38/50 (76%), Positives = 46/50 (92%) Frame = -1 Query: 543 DRLPLIPGVLELVGIGYTGWFVYQNLVFQPDREALLRKVTDTYNDIIGSN 394 D+LPL+PGVLELVGIGYTGWF Y+NL+F+PDREAL +KV DTY DI+GS+ Sbjct: 126 DKLPLVPGVLELVGIGYTGWFTYKNLIFKPDREALFQKVKDTYKDILGSS 175 >ref|XP_010241049.1| PREDICTED: protein CURVATURE THYLAKOID 1B, chloroplastic [Nelumbo nucifera] Length = 177 Score = 89.0 bits (219), Expect = 1e-15 Identities = 39/50 (78%), Positives = 45/50 (90%) Frame = -1 Query: 543 DRLPLIPGVLELVGIGYTGWFVYQNLVFQPDREALLRKVTDTYNDIIGSN 394 DRLPLIPGVLELVGIGYTGWF Y+NL+F+PDREAL +K+ D Y DIIGS+ Sbjct: 127 DRLPLIPGVLELVGIGYTGWFAYRNLIFKPDREALFQKIKDIYKDIIGSS 176 >gb|KFK37449.1| hypothetical protein AALP_AA4G258300 [Arabis alpina] Length = 176 Score = 89.0 bits (219), Expect = 1e-15 Identities = 38/50 (76%), Positives = 45/50 (90%) Frame = -1 Query: 543 DRLPLIPGVLELVGIGYTGWFVYQNLVFQPDREALLRKVTDTYNDIIGSN 394 DRLPL+PGVLELVGIGYTGWF Y+NL+F+PDRE L +KV DTY DI+GS+ Sbjct: 127 DRLPLVPGVLELVGIGYTGWFAYKNLIFKPDREVLFQKVKDTYKDILGSS 176 >ref|XP_008797634.1| PREDICTED: protein CURVATURE THYLAKOID 1B, chloroplastic [Phoenix dactylifera] Length = 178 Score = 89.0 bits (219), Expect = 1e-15 Identities = 38/50 (76%), Positives = 46/50 (92%) Frame = -1 Query: 543 DRLPLIPGVLELVGIGYTGWFVYQNLVFQPDREALLRKVTDTYNDIIGSN 394 DRLP++PGVLELVGIGYTGWF Y+NLVF+PDREAL+ K+ TY+DIIGS+ Sbjct: 129 DRLPIVPGVLELVGIGYTGWFAYRNLVFKPDREALIEKIKSTYSDIIGSS 178 >ref|XP_006397874.1| hypothetical protein EUTSA_v10001663mg [Eutrema salsugineum] gi|567166618|ref|XP_006397875.1| hypothetical protein EUTSA_v10001663mg [Eutrema salsugineum] gi|557098947|gb|ESQ39327.1| hypothetical protein EUTSA_v10001663mg [Eutrema salsugineum] gi|557098948|gb|ESQ39328.1| hypothetical protein EUTSA_v10001663mg [Eutrema salsugineum] Length = 170 Score = 89.0 bits (219), Expect = 1e-15 Identities = 38/50 (76%), Positives = 45/50 (90%) Frame = -1 Query: 543 DRLPLIPGVLELVGIGYTGWFVYQNLVFQPDREALLRKVTDTYNDIIGSN 394 DRLPL+PGVLELVGIGYTGWF Y+NL+F+PDRE L +KV DTY DI+GS+ Sbjct: 121 DRLPLVPGVLELVGIGYTGWFAYKNLIFKPDREVLFQKVKDTYKDILGSS 170 >ref|XP_007220420.1| hypothetical protein PRUPE_ppa012395mg [Prunus persica] gi|462416882|gb|EMJ21619.1| hypothetical protein PRUPE_ppa012395mg [Prunus persica] Length = 171 Score = 89.0 bits (219), Expect = 1e-15 Identities = 39/49 (79%), Positives = 44/49 (89%) Frame = -1 Query: 543 DRLPLIPGVLELVGIGYTGWFVYQNLVFQPDREALLRKVTDTYNDIIGS 397 DRLPL+PG LELVGIGYTGWF Y+NLVF+PDREAL +K+ DTY DIIGS Sbjct: 122 DRLPLVPGALELVGIGYTGWFAYKNLVFKPDREALTQKIKDTYKDIIGS 170