BLASTX nr result
ID: Cinnamomum24_contig00004873
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00004873 (417 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535169.1| conserved hypothetical protein [Ricinus comm... 83 4e-15 ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] 78 3e-12 >ref|XP_002535169.1| conserved hypothetical protein [Ricinus communis] gi|223523841|gb|EEF27214.1| conserved hypothetical protein [Ricinus communis] Length = 84 Score = 83.2 bits (204), Expect(2) = 4e-15 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = -3 Query: 127 SFLHRALTMSPEQSQYIWRKTIPHIEVGMGSGVFTSHRSARF 2 SFL+RA TMSPEQSQYIWRKTIPHIEVGMGSGVFTS+RSARF Sbjct: 38 SFLYRAWTMSPEQSQYIWRKTIPHIEVGMGSGVFTSYRSARF 79 Score = 24.6 bits (52), Expect(2) = 4e-15 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -2 Query: 173 RQAYTITLTSRIF 135 RQAYTI LT RIF Sbjct: 22 RQAYTIGLTDRIF 34 >ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] Length = 1152 Score = 77.8 bits (190), Expect = 3e-12 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +2 Query: 2 KPGTTVRRENTRSHSDLDMWNRLAPYVLRLFGRHGQ 109 KPGTTVRRENTRSHSDLDMWNRLAPYVL+LFGRHG+ Sbjct: 569 KPGTTVRRENTRSHSDLDMWNRLAPYVLKLFGRHGK 604