BLASTX nr result
ID: Cinnamomum24_contig00004521
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00004521 (522 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI21837.3| unnamed protein product [Vitis vinifera] 62 1e-07 emb|CDP19552.1| unnamed protein product [Coffea canephora] 57 5e-06 >emb|CBI21837.3| unnamed protein product [Vitis vinifera] Length = 388 Score = 62.0 bits (149), Expect = 1e-07 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -3 Query: 388 QVKERAKGLKDFFKKGMKVVGQSCKKGWYKVKKIRG 281 Q+KERA+ LK FFKKG+K+VG SCKKGWYKV+ +RG Sbjct: 336 QLKERARELKTFFKKGVKIVGDSCKKGWYKVRHMRG 371 >emb|CDP19552.1| unnamed protein product [Coffea canephora] Length = 42 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -3 Query: 388 QVKERAKGLKDFFKKGMKVVGQSCKKGWYKVKKIR 284 +VKERAK LK F++G+K+VG SCKKGWYKVK IR Sbjct: 7 KVKERAKELKIIFQRGVKIVGDSCKKGWYKVKHIR 41