BLASTX nr result
ID: Cinnamomum24_contig00003662
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00003662 (281 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010535544.1| PREDICTED: histone H2B.11 [Tarenaya hassleri... 114 2e-23 ref|NP_200799.1| histone H2B [Arabidopsis thaliana] gi|27735192... 114 2e-23 ref|XP_006846076.2| PREDICTED: histone H2B [Amborella trichopoda] 114 3e-23 ref|XP_009140934.1| PREDICTED: histone H2B.3-like [Brassica rapa] 114 3e-23 ref|XP_009133865.1| PREDICTED: histone H2B.3 [Brassica rapa] gi|... 114 3e-23 emb|CDY15776.1| BnaC04g15480D [Brassica napus] 114 3e-23 emb|CDY72471.1| BnaCnng77830D [Brassica napus] 114 3e-23 emb|CDX77199.1| BnaC04g39940D [Brassica napus] 114 3e-23 emb|CDX95762.1| BnaC03g26430D [Brassica napus] 114 3e-23 emb|CDY71843.1| BnaA07g37520D [Brassica napus] 114 3e-23 ref|XP_006400898.1| hypothetical protein EUTSA_v10014927mg [Eutr... 114 3e-23 gb|ERN07750.1| hypothetical protein AMTR_s00012p00085300 [Ambore... 114 3e-23 ref|XP_006281264.1| hypothetical protein CARUB_v10027310mg [Caps... 114 3e-23 ref|XP_002864658.1| hypothetical protein ARALYDRAFT_496128 [Arab... 114 3e-23 ref|XP_002862747.1| hypothetical protein ARALYDRAFT_333229 [Arab... 114 3e-23 ref|XP_010109932.1| Histone H2B.3 [Morus notabilis] gi|587938141... 113 4e-23 ref|XP_012471398.1| PREDICTED: histone H2B [Gossypium raimondii]... 113 4e-23 ref|XP_012461908.1| PREDICTED: histone H2B-like [Gossypium raimo... 113 4e-23 ref|XP_012468377.1| PREDICTED: probable histone H2B.3 [Gossypium... 113 4e-23 ref|XP_011461274.1| PREDICTED: histone H2B-like [Fragaria vesca ... 113 4e-23 >ref|XP_010535544.1| PREDICTED: histone H2B.11 [Tarenaya hassleriana] Length = 150 Score = 114 bits (286), Expect = 2e-23 Identities = 57/57 (100%), Positives = 57/57 (100%) Frame = -3 Query: 171 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT 1 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT Sbjct: 60 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT 116 >ref|NP_200799.1| histone H2B [Arabidopsis thaliana] gi|27735192|sp|P40283.5|H2B11_ARATH RecName: Full=Histone H2B.11; AltName: Full=HTB4 gi|9757912|dbj|BAB08359.1| unnamed protein product [Arabidopsis thaliana] gi|16323079|gb|AAL15274.1| AT5g59910/mmn10_130 [Arabidopsis thaliana] gi|56236124|gb|AAV84518.1| At5g59910 [Arabidopsis thaliana] gi|98960893|gb|ABF58930.1| At5g59910 [Arabidopsis thaliana] gi|332009867|gb|AED97250.1| histone H2B [Arabidopsis thaliana] Length = 150 Score = 114 bits (286), Expect = 2e-23 Identities = 57/57 (100%), Positives = 57/57 (100%) Frame = -3 Query: 171 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT 1 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT Sbjct: 60 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT 116 >ref|XP_006846076.2| PREDICTED: histone H2B [Amborella trichopoda] Length = 281 Score = 114 bits (285), Expect = 3e-23 Identities = 56/57 (98%), Positives = 57/57 (100%) Frame = -3 Query: 171 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT 1 +ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT Sbjct: 191 IETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT 247 Score = 113 bits (282), Expect = 6e-23 Identities = 55/57 (96%), Positives = 57/57 (100%) Frame = -3 Query: 171 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT 1 +ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SKLARYNKKPTIT Sbjct: 58 IETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSKLARYNKKPTIT 114 >ref|XP_009140934.1| PREDICTED: histone H2B.3-like [Brassica rapa] Length = 149 Score = 114 bits (285), Expect = 3e-23 Identities = 56/57 (98%), Positives = 57/57 (100%) Frame = -3 Query: 171 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT 1 +ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT Sbjct: 59 IETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT 115 >ref|XP_009133865.1| PREDICTED: histone H2B.3 [Brassica rapa] gi|674950111|emb|CDX83300.1| BnaA03g22060D [Brassica napus] Length = 155 Score = 114 bits (285), Expect = 3e-23 Identities = 56/57 (98%), Positives = 57/57 (100%) Frame = -3 Query: 171 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT 1 +ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT Sbjct: 65 IETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT 121 >emb|CDY15776.1| BnaC04g15480D [Brassica napus] Length = 148 Score = 114 bits (285), Expect = 3e-23 Identities = 56/57 (98%), Positives = 57/57 (100%) Frame = -3 Query: 171 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT 1 +ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT Sbjct: 58 IETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT 114 >emb|CDY72471.1| BnaCnng77830D [Brassica napus] Length = 153 Score = 114 bits (285), Expect = 3e-23 Identities = 56/57 (98%), Positives = 57/57 (100%) Frame = -3 Query: 171 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT 1 +ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT Sbjct: 63 IETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT 119 >emb|CDX77199.1| BnaC04g39940D [Brassica napus] Length = 154 Score = 114 bits (285), Expect = 3e-23 Identities = 56/57 (98%), Positives = 57/57 (100%) Frame = -3 Query: 171 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT 1 +ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT Sbjct: 64 IETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT 120 >emb|CDX95762.1| BnaC03g26430D [Brassica napus] Length = 151 Score = 114 bits (285), Expect = 3e-23 Identities = 56/57 (98%), Positives = 57/57 (100%) Frame = -3 Query: 171 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT 1 +ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT Sbjct: 61 IETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT 117 >emb|CDY71843.1| BnaA07g37520D [Brassica napus] Length = 149 Score = 114 bits (285), Expect = 3e-23 Identities = 56/57 (98%), Positives = 57/57 (100%) Frame = -3 Query: 171 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT 1 +ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT Sbjct: 59 IETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT 115 >ref|XP_006400898.1| hypothetical protein EUTSA_v10014927mg [Eutrema salsugineum] gi|557101988|gb|ESQ42351.1| hypothetical protein EUTSA_v10014927mg [Eutrema salsugineum] Length = 150 Score = 114 bits (285), Expect = 3e-23 Identities = 56/57 (98%), Positives = 57/57 (100%) Frame = -3 Query: 171 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT 1 +ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT Sbjct: 60 IETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT 116 >gb|ERN07750.1| hypothetical protein AMTR_s00012p00085300 [Amborella trichopoda] Length = 139 Score = 114 bits (285), Expect = 3e-23 Identities = 56/57 (98%), Positives = 57/57 (100%) Frame = -3 Query: 171 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT 1 +ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT Sbjct: 49 IETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT 105 >ref|XP_006281264.1| hypothetical protein CARUB_v10027310mg [Capsella rubella] gi|482549968|gb|EOA14162.1| hypothetical protein CARUB_v10027310mg [Capsella rubella] Length = 150 Score = 114 bits (285), Expect = 3e-23 Identities = 56/57 (98%), Positives = 57/57 (100%) Frame = -3 Query: 171 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT 1 +ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT Sbjct: 60 IETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT 116 >ref|XP_002864658.1| hypothetical protein ARALYDRAFT_496128 [Arabidopsis lyrata subsp. lyrata] gi|297310493|gb|EFH40917.1| hypothetical protein ARALYDRAFT_496128, partial [Arabidopsis lyrata subsp. lyrata] Length = 145 Score = 114 bits (285), Expect = 3e-23 Identities = 56/57 (98%), Positives = 57/57 (100%) Frame = -3 Query: 171 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT 1 +ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT Sbjct: 57 IETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT 113 >ref|XP_002862747.1| hypothetical protein ARALYDRAFT_333229 [Arabidopsis lyrata subsp. lyrata] gi|297308453|gb|EFH39005.1| hypothetical protein ARALYDRAFT_333229 [Arabidopsis lyrata subsp. lyrata] Length = 137 Score = 114 bits (285), Expect = 3e-23 Identities = 56/57 (98%), Positives = 57/57 (100%) Frame = -3 Query: 171 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT 1 +ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT Sbjct: 47 IETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT 103 >ref|XP_010109932.1| Histone H2B.3 [Morus notabilis] gi|587938141|gb|EXC24908.1| Histone H2B.3 [Morus notabilis] Length = 146 Score = 113 bits (283), Expect = 4e-23 Identities = 56/57 (98%), Positives = 57/57 (100%) Frame = -3 Query: 171 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT 1 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAS+LARYNKKPTIT Sbjct: 56 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTIT 112 >ref|XP_012471398.1| PREDICTED: histone H2B [Gossypium raimondii] gi|7387726|sp|O22582.3|H2B_GOSHI RecName: Full=Histone H2B [Gossypium hirsutum] gi|2558962|gb|AAB97163.1| histone H2B1 [Gossypium hirsutum] gi|763752774|gb|KJB20162.1| hypothetical protein B456_003G136000 [Gossypium raimondii] Length = 147 Score = 113 bits (283), Expect = 4e-23 Identities = 56/57 (98%), Positives = 57/57 (100%) Frame = -3 Query: 171 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT 1 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAS+LARYNKKPTIT Sbjct: 57 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTIT 113 >ref|XP_012461908.1| PREDICTED: histone H2B-like [Gossypium raimondii] Length = 288 Score = 113 bits (283), Expect = 4e-23 Identities = 56/57 (98%), Positives = 57/57 (100%) Frame = -3 Query: 171 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT 1 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAS+LARYNKKPTIT Sbjct: 198 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTIT 254 Score = 112 bits (279), Expect = 1e-22 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = -3 Query: 168 ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT 1 ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAS+LARYNKKPTIT Sbjct: 58 ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTIT 113 >ref|XP_012468377.1| PREDICTED: probable histone H2B.3 [Gossypium raimondii] Length = 138 Score = 113 bits (283), Expect = 4e-23 Identities = 56/57 (98%), Positives = 57/57 (100%) Frame = -3 Query: 171 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT 1 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAS+LARYNKKPTIT Sbjct: 48 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTIT 104 >ref|XP_011461274.1| PREDICTED: histone H2B-like [Fragaria vesca subsp. vesca] Length = 284 Score = 113 bits (283), Expect = 4e-23 Identities = 56/57 (98%), Positives = 57/57 (100%) Frame = -3 Query: 171 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT 1 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SKLARYNKKPTIT Sbjct: 194 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSKLARYNKKPTIT 250 Score = 112 bits (280), Expect = 1e-22 Identities = 55/57 (96%), Positives = 57/57 (100%) Frame = -3 Query: 171 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT 1 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+S+LARYNKKPTIT Sbjct: 55 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTIT 111