BLASTX nr result
ID: Cinnamomum23_contig00007347
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00007347 (593 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006852460.1| PREDICTED: 50S ribosomal protein L34, chloro... 123 6e-26 ref|XP_012450509.1| PREDICTED: 50S ribosomal protein L34, chloro... 122 1e-25 ref|XP_009386293.1| PREDICTED: 50S ribosomal protein L34, chloro... 120 4e-25 gb|KHG06612.1| 50S ribosomal protein L34, chloroplastic [Gossypi... 119 8e-25 gb|KHG06610.1| 50S ribosomal protein L34, chloroplastic [Gossypi... 119 8e-25 ref|XP_010277750.1| PREDICTED: 50S ribosomal protein L34, chloro... 119 1e-24 ref|XP_012445398.1| PREDICTED: 50S ribosomal protein L34, chloro... 118 2e-24 ref|XP_007025416.1| 50S ribosomal protein L34 [Theobroma cacao] ... 118 2e-24 ref|XP_002274637.2| PREDICTED: 50S ribosomal protein L34, chloro... 117 4e-24 emb|CBI30669.3| unnamed protein product [Vitis vinifera] 117 4e-24 emb|CAN60201.1| hypothetical protein VITISV_036402 [Vitis vinifera] 117 4e-24 gb|KJB63243.1| hypothetical protein B456_010G1587002, partial [G... 117 5e-24 ref|NP_001044556.2| Os01g0805000, partial [Oryza sativa Japonica... 117 5e-24 dbj|BAD68168.1| putative plastid ribosomal protein L34 precursor... 117 5e-24 ref|XP_002522558.1| 50S ribosomal protein L34, chloroplast precu... 115 1e-23 ref|XP_010279092.1| PREDICTED: 50S ribosomal protein L34, chloro... 115 2e-23 ref|XP_008788554.1| PREDICTED: 50S ribosomal protein L34, chloro... 115 2e-23 ref|NP_001149346.1| 50S ribosomal protein L34 [Zea mays] gi|1956... 115 2e-23 ref|XP_010906403.1| PREDICTED: 50S ribosomal protein L34, chloro... 114 3e-23 ref|XP_006644865.1| PREDICTED: 50S ribosomal protein L34, chloro... 114 4e-23 >ref|XP_006852460.1| PREDICTED: 50S ribosomal protein L34, chloroplastic [Amborella trichopoda] gi|548856071|gb|ERN13927.1| hypothetical protein AMTR_s00021p00119000 [Amborella trichopoda] Length = 141 Score = 123 bits (309), Expect = 6e-26 Identities = 62/78 (79%), Positives = 67/78 (85%) Frame = -3 Query: 369 RVDFNYRKVVKERSRVVQVRAVKYSLCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRR 190 +VD KVV+ERSRVVQVRA K LC TKR+RSRKSLARTHGFRRRMRTT GRAVL RR Sbjct: 62 KVDLRVNKVVRERSRVVQVRAGKARLCMTKRSRSRKSLARTHGFRRRMRTTGGRAVLNRR 121 Query: 189 RAKGRKVLCTKSNPNSGK 136 RAKGRKVLCTK+N N+GK Sbjct: 122 RAKGRKVLCTKTNSNTGK 139 >ref|XP_012450509.1| PREDICTED: 50S ribosomal protein L34, chloroplastic [Gossypium raimondii] gi|763796287|gb|KJB63242.1| hypothetical protein B456_010G1587002 [Gossypium raimondii] Length = 153 Score = 122 bits (307), Expect = 1e-25 Identities = 65/77 (84%), Positives = 67/77 (87%), Gaps = 1/77 (1%) Frame = -3 Query: 363 DFNYRKVVK-ERSRVVQVRAVKYSLCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRR 187 DF K VK ER R + VRA K +LCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRR Sbjct: 76 DFGSNKGVKNERRRCLVVRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRR 135 Query: 186 AKGRKVLCTKSNPNSGK 136 AKGRKVLCTKSNPNSGK Sbjct: 136 AKGRKVLCTKSNPNSGK 152 >ref|XP_009386293.1| PREDICTED: 50S ribosomal protein L34, chloroplastic [Musa acuminata subsp. malaccensis] Length = 148 Score = 120 bits (302), Expect = 4e-25 Identities = 61/77 (79%), Positives = 67/77 (87%) Frame = -3 Query: 366 VDFNYRKVVKERSRVVQVRAVKYSLCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRR 187 VD +VVKER R +QVRA K +LC TKR+RSRKSLARTHGFRRRMRT SGRAV++RRR Sbjct: 70 VDLGSSRVVKERYRGLQVRAGKAALCTTKRSRSRKSLARTHGFRRRMRTPSGRAVIRRRR 129 Query: 186 AKGRKVLCTKSNPNSGK 136 AKGRKVLCTKSNPNSGK Sbjct: 130 AKGRKVLCTKSNPNSGK 146 >gb|KHG06612.1| 50S ribosomal protein L34, chloroplastic [Gossypium arboreum] Length = 250 Score = 119 bits (299), Expect = 8e-25 Identities = 63/77 (81%), Positives = 66/77 (85%), Gaps = 1/77 (1%) Frame = -3 Query: 363 DFNYRKVVK-ERSRVVQVRAVKYSLCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRR 187 DF VK ER R + VRA K +LCQTKRNRSRKSLARTHGFRRRMRTTSGRA+LKRRR Sbjct: 173 DFGSNNGVKNERRRCLVVRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRALLKRRR 232 Query: 186 AKGRKVLCTKSNPNSGK 136 AKGRKVLCTKSNPNSGK Sbjct: 233 AKGRKVLCTKSNPNSGK 249 >gb|KHG06610.1| 50S ribosomal protein L34, chloroplastic [Gossypium arboreum] Length = 442 Score = 119 bits (299), Expect = 8e-25 Identities = 63/77 (81%), Positives = 66/77 (85%), Gaps = 1/77 (1%) Frame = -3 Query: 363 DFNYRKVVK-ERSRVVQVRAVKYSLCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRR 187 DF VK ER R + VRA K +LCQTKRNRSRKSLARTHGFRRRMRTTSGRA+LKRRR Sbjct: 365 DFGSNNGVKNERRRCLVVRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRALLKRRR 424 Query: 186 AKGRKVLCTKSNPNSGK 136 AKGRKVLCTKSNPNSGK Sbjct: 425 AKGRKVLCTKSNPNSGK 441 >ref|XP_010277750.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Nelumbo nucifera] Length = 150 Score = 119 bits (297), Expect = 1e-24 Identities = 62/78 (79%), Positives = 66/78 (84%), Gaps = 1/78 (1%) Frame = -3 Query: 366 VDFNYRKVVK-ERSRVVQVRAVKYSLCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRR 190 VD + VV+ E R + VRA K +LCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRR Sbjct: 71 VDLRFNNVVRRENGRGLVVRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRR 130 Query: 189 RAKGRKVLCTKSNPNSGK 136 RAKGRKVLC KSNPNSGK Sbjct: 131 RAKGRKVLCPKSNPNSGK 148 >ref|XP_012445398.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Gossypium raimondii] gi|763790434|gb|KJB57430.1| hypothetical protein B456_009G163700 [Gossypium raimondii] Length = 157 Score = 118 bits (296), Expect = 2e-24 Identities = 62/78 (79%), Positives = 68/78 (87%), Gaps = 1/78 (1%) Frame = -3 Query: 366 VDFNYRKVVK-ERSRVVQVRAVKYSLCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRR 190 +DF+ V+ E+ R + VRA K +LCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRR Sbjct: 79 MDFSSNNGVRNEKRRGLVVRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRR 138 Query: 189 RAKGRKVLCTKSNPNSGK 136 RAKGRKVLCTKSNPNSGK Sbjct: 139 RAKGRKVLCTKSNPNSGK 156 >ref|XP_007025416.1| 50S ribosomal protein L34 [Theobroma cacao] gi|508780782|gb|EOY28038.1| 50S ribosomal protein L34 [Theobroma cacao] Length = 158 Score = 118 bits (296), Expect = 2e-24 Identities = 62/78 (79%), Positives = 68/78 (87%), Gaps = 1/78 (1%) Frame = -3 Query: 366 VDFNYRKVVK-ERSRVVQVRAVKYSLCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRR 190 +DF+ V+ E+ R + VRA K +LCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRR Sbjct: 79 MDFSSNNGVRNEKRRGLVVRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRR 138 Query: 189 RAKGRKVLCTKSNPNSGK 136 RAKGRKVLCTKSNPNSGK Sbjct: 139 RAKGRKVLCTKSNPNSGK 156 >ref|XP_002274637.2| PREDICTED: 50S ribosomal protein L34, chloroplastic [Vitis vinifera] Length = 174 Score = 117 bits (293), Expect = 4e-24 Identities = 60/70 (85%), Positives = 63/70 (90%) Frame = -3 Query: 345 VVKERSRVVQVRAVKYSLCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVL 166 V KER + VRA K +LCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVL Sbjct: 103 VRKERGHGLVVRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVL 162 Query: 165 CTKSNPNSGK 136 CTKSNP+SGK Sbjct: 163 CTKSNPSSGK 172 >emb|CBI30669.3| unnamed protein product [Vitis vinifera] Length = 113 Score = 117 bits (293), Expect = 4e-24 Identities = 60/70 (85%), Positives = 63/70 (90%) Frame = -3 Query: 345 VVKERSRVVQVRAVKYSLCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVL 166 V KER + VRA K +LCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVL Sbjct: 42 VRKERGHGLVVRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVL 101 Query: 165 CTKSNPNSGK 136 CTKSNP+SGK Sbjct: 102 CTKSNPSSGK 111 >emb|CAN60201.1| hypothetical protein VITISV_036402 [Vitis vinifera] Length = 148 Score = 117 bits (293), Expect = 4e-24 Identities = 60/70 (85%), Positives = 63/70 (90%) Frame = -3 Query: 345 VVKERSRVVQVRAVKYSLCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVL 166 V KER + VRA K +LCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVL Sbjct: 77 VRKERGHGLVVRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVL 136 Query: 165 CTKSNPNSGK 136 CTKSNP+SGK Sbjct: 137 CTKSNPSSGK 146 >gb|KJB63243.1| hypothetical protein B456_010G1587002, partial [Gossypium raimondii] Length = 149 Score = 117 bits (292), Expect = 5e-24 Identities = 62/74 (83%), Positives = 64/74 (86%), Gaps = 1/74 (1%) Frame = -3 Query: 363 DFNYRKVVK-ERSRVVQVRAVKYSLCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRR 187 DF K VK ER R + VRA K +LCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRR Sbjct: 76 DFGSNKGVKNERRRCLVVRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRR 135 Query: 186 AKGRKVLCTKSNPN 145 AKGRKVLCTKSNPN Sbjct: 136 AKGRKVLCTKSNPN 149 >ref|NP_001044556.2| Os01g0805000, partial [Oryza sativa Japonica Group] gi|255673789|dbj|BAF06470.2| Os01g0805000, partial [Oryza sativa Japonica Group] Length = 95 Score = 117 bits (292), Expect = 5e-24 Identities = 55/77 (71%), Positives = 67/77 (87%) Frame = -3 Query: 366 VDFNYRKVVKERSRVVQVRAVKYSLCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRR 187 ++F+Y +V RSR++Q+RA K +LC TKRNRSRKSLARTHGFRRRMRTT+GR VLKRRR Sbjct: 15 IEFSYNRVTTGRSRILQIRAGKAALCMTKRNRSRKSLARTHGFRRRMRTTAGRKVLKRRR 74 Query: 186 AKGRKVLCTKSNPNSGK 136 AKGR+VLCTK+N +GK Sbjct: 75 AKGRRVLCTKTNSPTGK 91 >dbj|BAD68168.1| putative plastid ribosomal protein L34 precursor [Oryza sativa Japonica Group] gi|125528074|gb|EAY76188.1| hypothetical protein OsI_04121 [Oryza sativa Indica Group] gi|125572355|gb|EAZ13870.1| hypothetical protein OsJ_03794 [Oryza sativa Japonica Group] Length = 167 Score = 117 bits (292), Expect = 5e-24 Identities = 55/77 (71%), Positives = 67/77 (87%) Frame = -3 Query: 366 VDFNYRKVVKERSRVVQVRAVKYSLCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRR 187 ++F+Y +V RSR++Q+RA K +LC TKRNRSRKSLARTHGFRRRMRTT+GR VLKRRR Sbjct: 87 IEFSYNRVTTGRSRILQIRAGKAALCMTKRNRSRKSLARTHGFRRRMRTTAGRKVLKRRR 146 Query: 186 AKGRKVLCTKSNPNSGK 136 AKGR+VLCTK+N +GK Sbjct: 147 AKGRRVLCTKTNSPTGK 163 >ref|XP_002522558.1| 50S ribosomal protein L34, chloroplast precursor, putative [Ricinus communis] gi|223538249|gb|EEF39858.1| 50S ribosomal protein L34, chloroplast precursor, putative [Ricinus communis] Length = 161 Score = 115 bits (289), Expect = 1e-23 Identities = 60/70 (85%), Positives = 62/70 (88%) Frame = -3 Query: 345 VVKERSRVVQVRAVKYSLCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVL 166 V K R + VRA K +LCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVL Sbjct: 90 VRKGRGYGLVVRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVL 149 Query: 165 CTKSNPNSGK 136 CTKSNPNSGK Sbjct: 150 CTKSNPNSGK 159 >ref|XP_010279092.1| PREDICTED: 50S ribosomal protein L34, chloroplastic [Nelumbo nucifera] gi|720074682|ref|XP_010279093.1| PREDICTED: 50S ribosomal protein L34, chloroplastic [Nelumbo nucifera] gi|720074685|ref|XP_010279094.1| PREDICTED: 50S ribosomal protein L34, chloroplastic [Nelumbo nucifera] gi|720074688|ref|XP_010279095.1| PREDICTED: 50S ribosomal protein L34, chloroplastic [Nelumbo nucifera] Length = 151 Score = 115 bits (288), Expect = 2e-23 Identities = 61/78 (78%), Positives = 66/78 (84%), Gaps = 1/78 (1%) Frame = -3 Query: 366 VDFNYRKVVK-ERSRVVQVRAVKYSLCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRR 190 VD N V++ E+SR + VRA K +LCQTKRNRSRKSLARTHGFRRRMR TSGRAVLKRR Sbjct: 72 VDLNLNNVMRREKSRGLVVRAGKAALCQTKRNRSRKSLARTHGFRRRMRITSGRAVLKRR 131 Query: 189 RAKGRKVLCTKSNPNSGK 136 RAKGRKVLC KS PNSGK Sbjct: 132 RAKGRKVLCPKSYPNSGK 149 >ref|XP_008788554.1| PREDICTED: 50S ribosomal protein L34, chloroplastic [Phoenix dactylifera] Length = 148 Score = 115 bits (288), Expect = 2e-23 Identities = 59/77 (76%), Positives = 65/77 (84%) Frame = -3 Query: 366 VDFNYRKVVKERSRVVQVRAVKYSLCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRR 187 +D KVV+ER +QVRA K +LC TKR+RSRKSLARTHGFRRR+RTT GRAVLKRRR Sbjct: 70 IDLVSNKVVRERYHGLQVRAGKAALCLTKRSRSRKSLARTHGFRRRIRTTGGRAVLKRRR 129 Query: 186 AKGRKVLCTKSNPNSGK 136 AKGRKVLCTKS PNSGK Sbjct: 130 AKGRKVLCTKSYPNSGK 146 >ref|NP_001149346.1| 50S ribosomal protein L34 [Zea mays] gi|195626574|gb|ACG35117.1| 50S ribosomal protein L34 [Zea mays] gi|414880085|tpg|DAA57216.1| TPA: 50S ribosomal protein L34 [Zea mays] Length = 169 Score = 115 bits (288), Expect = 2e-23 Identities = 56/77 (72%), Positives = 66/77 (85%) Frame = -3 Query: 366 VDFNYRKVVKERSRVVQVRAVKYSLCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRR 187 ++F+Y + RSR +Q+RA K +LC TKR+RSRKSLARTHGFRRRMRTTSGR VLKRRR Sbjct: 89 IEFSYSIMTTRRSRGMQIRAGKAALCMTKRSRSRKSLARTHGFRRRMRTTSGRKVLKRRR 148 Query: 186 AKGRKVLCTKSNPNSGK 136 AKGRKVLCT++N NSGK Sbjct: 149 AKGRKVLCTRTNSNSGK 165 >ref|XP_010906403.1| PREDICTED: 50S ribosomal protein L34, chloroplastic [Elaeis guineensis] Length = 148 Score = 114 bits (286), Expect = 3e-23 Identities = 59/76 (77%), Positives = 63/76 (82%) Frame = -3 Query: 366 VDFNYRKVVKERSRVVQVRAVKYSLCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRR 187 +D KVV+ER +QVRA K L TKR+RSRKSLARTHGFRRRMRTT GRAVLKRRR Sbjct: 70 IDLGSTKVVRERYHGLQVRAGKAGLSLTKRSRSRKSLARTHGFRRRMRTTGGRAVLKRRR 129 Query: 186 AKGRKVLCTKSNPNSG 139 AKGRKVLCTKSNPNSG Sbjct: 130 AKGRKVLCTKSNPNSG 145 >ref|XP_006644865.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Oryza brachyantha] Length = 167 Score = 114 bits (284), Expect = 4e-23 Identities = 54/77 (70%), Positives = 66/77 (85%) Frame = -3 Query: 366 VDFNYRKVVKERSRVVQVRAVKYSLCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRR 187 ++F+Y +V RSR++Q+RA K +LC TKR+RSRKSLARTHGFRRRMRTT+GR VLKRRR Sbjct: 87 IEFSYNRVTTGRSRILQIRAGKAALCMTKRSRSRKSLARTHGFRRRMRTTAGRKVLKRRR 146 Query: 186 AKGRKVLCTKSNPNSGK 136 KGRKVLCTK+N +GK Sbjct: 147 DKGRKVLCTKTNSPTGK 163