BLASTX nr result
ID: Cimicifuga21_contig00040333
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00040333 (265 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517454.1| conserved hypothetical protein [Ricinus comm... 59 3e-07 >ref|XP_002517454.1| conserved hypothetical protein [Ricinus communis] gi|223543465|gb|EEF44996.1| conserved hypothetical protein [Ricinus communis] Length = 401 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/58 (48%), Positives = 39/58 (67%) Frame = -3 Query: 176 FSKLPGDVFFDILSRLTIKTISRCRWVSKTWYNLVTHPLLAKLHYARAVQSNSLCAVF 3 F KLP +++FDILSR I ++ C+ VS+ WY V +PLLA +H RA + N LC +F Sbjct: 19 FEKLPQEIYFDILSRQPIVSLLECKPVSRHWYTSVRNPLLANMHLNRAAEQN-LCLLF 75