BLASTX nr result
ID: Cimicifuga21_contig00039666
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00039666 (278 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511313.1| pentatricopeptide repeat-containing protein,... 96 4e-18 ref|XP_002277390.1| PREDICTED: pentatricopeptide repeat-containi... 93 3e-17 ref|XP_003550712.1| PREDICTED: pentatricopeptide repeat-containi... 81 1e-13 ref|XP_003549820.1| PREDICTED: pentatricopeptide repeat-containi... 75 4e-12 ref|XP_004138087.1| PREDICTED: pentatricopeptide repeat-containi... 71 8e-11 >ref|XP_002511313.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550428|gb|EEF51915.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 627 Score = 95.5 bits (236), Expect = 4e-18 Identities = 42/91 (46%), Positives = 65/91 (71%) Frame = -3 Query: 276 NWVSVKHGFKPSLPVYGLMLRILGNKDTMNEFWVLIRKMSDEGCDVDTKSYRPVLGNFKS 97 NWV ++GFKPS P+Y LMLRIL KD+M FW+ +RKM ++G D ++Y +LG F+ Sbjct: 114 NWVCDRNGFKPSSPLYSLMLRILVKKDSMKNFWITLRKMKEQGFYTDEETYLTILGVFRK 173 Query: 96 LKMTNEAIAWTEYFNKMTKESATDATVKVVV 4 +M ++A+A+ +F++M +E+A D+ VK VV Sbjct: 174 ERMDSDAVAFKHFFDRMVEENAMDSVVKNVV 204 >ref|XP_002277390.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Vitis vinifera] Length = 631 Score = 92.8 bits (229), Expect = 3e-17 Identities = 42/92 (45%), Positives = 65/92 (70%) Frame = -3 Query: 276 NWVSVKHGFKPSLPVYGLMLRILGNKDTMNEFWVLIRKMSDEGCDVDTKSYRPVLGNFKS 97 NWV+ K+GF+PS +Y L+LR L + ++M +FWV IRKM ++G +D ++Y +LG FK Sbjct: 116 NWVTEKNGFRPSSAMYSLILRSLVHGESMKQFWVTIRKMKEQGFCIDKETYLTILGVFKK 175 Query: 96 LKMTNEAIAWTEYFNKMTKESATDATVKVVVD 1 KM +E +A T ++N+M +E+A D VK VV+ Sbjct: 176 GKMASEEVALTHFYNRMVQENAMDEVVKKVVE 207 >ref|XP_003550712.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Glycine max] Length = 635 Score = 80.9 bits (198), Expect = 1e-13 Identities = 38/91 (41%), Positives = 58/91 (63%) Frame = -3 Query: 276 NWVSVKHGFKPSLPVYGLMLRILGNKDTMNEFWVLIRKMSDEGCDVDTKSYRPVLGNFKS 97 NWV K F+PS VY L++RIL KDTM +FWV +R M + G +D ++Y + FK Sbjct: 115 NWVCKKVWFRPSCSVYSLIVRILAAKDTMKQFWVTLRMMKENGFFLDEETYLTISVGFKR 174 Query: 96 LKMTNEAIAWTEYFNKMTKESATDATVKVVV 4 KM ++++A T ++N+M +E+A + V VV Sbjct: 175 EKMDSDSVALTHFYNRMLEENAMQSVVSNVV 205 >ref|XP_003549820.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Glycine max] Length = 635 Score = 75.5 bits (184), Expect = 4e-12 Identities = 33/92 (35%), Positives = 55/92 (59%) Frame = -3 Query: 276 NWVSVKHGFKPSLPVYGLMLRILGNKDTMNEFWVLIRKMSDEGCDVDTKSYRPVLGNFKS 97 NWVS K ++PS +YGL+LR+L ++T+ FW+ +R M +G D + Y P+L FK Sbjct: 119 NWVSAKEWYRPSSSLYGLILRVLATEETIKLFWITLRTMKTKGFYFDEEMYFPILAGFKR 178 Query: 96 LKMTNEAIAWTEYFNKMTKESATDATVKVVVD 1 M + ++ T ++++ +E+A V VVD Sbjct: 179 KNMNKDRVSLTRFYSQGIQENAMQIVVTKVVD 210 >ref|XP_004138087.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Cucumis sativus] gi|449524136|ref|XP_004169079.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Cucumis sativus] Length = 632 Score = 71.2 bits (173), Expect = 8e-11 Identities = 31/92 (33%), Positives = 55/92 (59%) Frame = -3 Query: 276 NWVSVKHGFKPSLPVYGLMLRILGNKDTMNEFWVLIRKMSDEGCDVDTKSYRPVLGNFKS 97 NW S K+G S +Y ++LRI ++M FW+ +R M + G +D ++Y+ +LG + Sbjct: 109 NWASGKNGSTQSSSIYSMLLRIFVQNESMKLFWITLRLMKERGFYLDEETYKTILGVLRK 168 Query: 96 LKMTNEAIAWTEYFNKMTKESATDATVKVVVD 1 K +A T ++N+M +++A D+ V+ VVD Sbjct: 169 SKKAADATGLTHFYNRMLQQNAMDSVVQKVVD 200