BLASTX nr result
ID: Cimicifuga21_contig00039330
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00039330 (227 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282803.1| PREDICTED: pentatricopeptide repeat-containi... 114 1e-23 emb|CAN74403.1| hypothetical protein VITISV_043633 [Vitis vinifera] 114 1e-23 ref|XP_004161700.1| PREDICTED: pentatricopeptide repeat-containi... 100 1e-19 ref|XP_004142223.1| PREDICTED: pentatricopeptide repeat-containi... 100 1e-19 ref|XP_002284744.1| PREDICTED: pentatricopeptide repeat-containi... 93 2e-17 >ref|XP_002282803.1| PREDICTED: pentatricopeptide repeat-containing protein At2g40720-like [Vitis vinifera] Length = 854 Score = 114 bits (284), Expect = 1e-23 Identities = 52/75 (69%), Positives = 62/75 (82%) Frame = -1 Query: 227 IEPDASVWRALLSACRVYSEAELARTVFKKLVELEPMNVGNYILLSNIYAAGGLWEEAGN 48 IEPDASVWRALLS+CR YS+A+ A+T+F+KL +LEPMN GNY+LLSN+YA GLW E Sbjct: 725 IEPDASVWRALLSSCRAYSDAKQAKTIFEKLDKLEPMNAGNYVLLSNVYATAGLWLEVRR 784 Query: 47 LRTELKNKNLRKPPG 3 +RT LK K LRKPPG Sbjct: 785 IRTWLKEKGLRKPPG 799 >emb|CAN74403.1| hypothetical protein VITISV_043633 [Vitis vinifera] Length = 841 Score = 114 bits (284), Expect = 1e-23 Identities = 52/75 (69%), Positives = 62/75 (82%) Frame = -1 Query: 227 IEPDASVWRALLSACRVYSEAELARTVFKKLVELEPMNVGNYILLSNIYAAGGLWEEAGN 48 IEPDASVWRALLS+CR YS+A+ A+T+F+KL +LEPMN GNY+LLSN+YA GLW E Sbjct: 712 IEPDASVWRALLSSCRAYSDAKQAKTIFEKLDKLEPMNAGNYVLLSNVYATAGLWLEVRR 771 Query: 47 LRTELKNKNLRKPPG 3 +RT LK K LRKPPG Sbjct: 772 IRTWLKEKGLRKPPG 786 >ref|XP_004161700.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330-like [Cucumis sativus] Length = 847 Score = 100 bits (249), Expect = 1e-19 Identities = 47/75 (62%), Positives = 57/75 (76%) Frame = -1 Query: 227 IEPDASVWRALLSACRVYSEAELARTVFKKLVELEPMNVGNYILLSNIYAAGGLWEEAGN 48 IEPDAS+WRALLS+C++ S +L T+F KLVELEP N GN+ILLSNIYAA GLW E Sbjct: 732 IEPDASIWRALLSSCQIKSNNKLLETIFGKLVELEPSNPGNFILLSNIYAAAGLWSEVVQ 791 Query: 47 LRTELKNKNLRKPPG 3 +R L+ + L KPPG Sbjct: 792 IRKWLRERGLGKPPG 806 >ref|XP_004142223.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330-like [Cucumis sativus] Length = 847 Score = 100 bits (249), Expect = 1e-19 Identities = 47/75 (62%), Positives = 57/75 (76%) Frame = -1 Query: 227 IEPDASVWRALLSACRVYSEAELARTVFKKLVELEPMNVGNYILLSNIYAAGGLWEEAGN 48 IEPDAS+WRALLS+C++ S +L T+F KLVELEP N GN+ILLSNIYAA GLW E Sbjct: 732 IEPDASIWRALLSSCQIKSNNKLLETIFGKLVELEPSNPGNFILLSNIYAAAGLWSEVVQ 791 Query: 47 LRTELKNKNLRKPPG 3 +R L+ + L KPPG Sbjct: 792 IRKWLRERGLGKPPG 806 >ref|XP_002284744.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230 [Vitis vinifera] Length = 758 Score = 93.2 bits (230), Expect = 2e-17 Identities = 43/75 (57%), Positives = 52/75 (69%) Frame = -1 Query: 227 IEPDASVWRALLSACRVYSEAELARTVFKKLVELEPMNVGNYILLSNIYAAGGLWEEAGN 48 + PDA VW ALLS+CRV++ L +KL ELEP N GNYILLSNIYA+ G+W E Sbjct: 551 VNPDACVWGALLSSCRVHNNVSLGEVAAEKLFELEPSNPGNYILLSNIYASKGMWNEVNR 610 Query: 47 LRTELKNKNLRKPPG 3 +R +KNK LRK PG Sbjct: 611 VRDMMKNKGLRKNPG 625