BLASTX nr result
ID: Cimicifuga21_contig00039091
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00039091 (259 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275952.1| PREDICTED: pentatricopeptide repeat-containi... 136 2e-30 ref|XP_003624580.1| Pentatricopeptide repeat-containing protein ... 133 1e-29 ref|XP_002319139.1| predicted protein [Populus trichocarpa] gi|2... 132 2e-29 ref|XP_002525469.1| pentatricopeptide repeat-containing protein,... 130 9e-29 ref|XP_003553325.1| PREDICTED: pentatricopeptide repeat-containi... 127 1e-27 >ref|XP_002275952.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15010, mitochondrial-like [Vitis vinifera] Length = 566 Score = 136 bits (343), Expect = 2e-30 Identities = 63/86 (73%), Positives = 72/86 (83%) Frame = +1 Query: 1 NTFYALKRFKFEIGIAEFQDLLSALCRYKNVQDAEHLLFCNEKVFPLNTKSLNIILNGWC 180 NTFYA K+FKF +GI EFQ+LLSALCRYKNVQDAE LLFCN VFP +TKS NIILNGWC Sbjct: 206 NTFYAHKQFKFGVGIEEFQNLLSALCRYKNVQDAEQLLFCNRNVFPFDTKSFNIILNGWC 265 Query: 181 NMIVNLREAKRFWRLMGRKGIARDTV 258 N+I ++REA+RFWR M +GI RD V Sbjct: 266 NVIGSMREAERFWREMSNRGIQRDVV 291 >ref|XP_003624580.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355499595|gb|AES80798.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 585 Score = 133 bits (335), Expect = 1e-29 Identities = 60/86 (69%), Positives = 70/86 (81%) Frame = +1 Query: 1 NTFYALKRFKFEIGIAEFQDLLSALCRYKNVQDAEHLLFCNEKVFPLNTKSLNIILNGWC 180 NTFYA KRF F++G+ EFQ LLSALCRYKNVQDAEHLLFCN+ VFPL+TKS NIILNGWC Sbjct: 224 NTFYAFKRFNFQVGLYEFQGLLSALCRYKNVQDAEHLLFCNKNVFPLDTKSFNIILNGWC 283 Query: 181 NMIVNLREAKRFWRLMGRKGIARDTV 258 N+IV+ R A+R W M ++ I D V Sbjct: 284 NLIVSARNAERIWEEMSKRRIQHDVV 309 >ref|XP_002319139.1| predicted protein [Populus trichocarpa] gi|222857515|gb|EEE95062.1| predicted protein [Populus trichocarpa] Length = 518 Score = 132 bits (333), Expect = 2e-29 Identities = 60/86 (69%), Positives = 72/86 (83%) Frame = +1 Query: 1 NTFYALKRFKFEIGIAEFQDLLSALCRYKNVQDAEHLLFCNEKVFPLNTKSLNIILNGWC 180 NTFYA KRFKF++GI EFQ LLSALCRYKNVQDAE L++CN+ VFPLNTKS NI+LNGWC Sbjct: 148 NTFYAYKRFKFDMGIEEFQSLLSALCRYKNVQDAEQLMYCNKAVFPLNTKSFNIVLNGWC 207 Query: 181 NMIVNLREAKRFWRLMGRKGIARDTV 258 N+I + RE++R WR M ++GI D V Sbjct: 208 NLIGSPRESERVWREMSKRGIRFDVV 233 >ref|XP_002525469.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223535282|gb|EEF36959.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 581 Score = 130 bits (328), Expect = 9e-29 Identities = 61/86 (70%), Positives = 70/86 (81%) Frame = +1 Query: 1 NTFYALKRFKFEIGIAEFQDLLSALCRYKNVQDAEHLLFCNEKVFPLNTKSLNIILNGWC 180 NTFYA KRFKF++GI EFQ LLSALCRYKNVQDAEHL+FCN+ VFP NTKS NI+LNGWC Sbjct: 220 NTFYAHKRFKFDLGIDEFQSLLSALCRYKNVQDAEHLMFCNKDVFPFNTKSFNIVLNGWC 279 Query: 181 NMIVNLREAKRFWRLMGRKGIARDTV 258 N+I + REA R WR M ++ I D V Sbjct: 280 NVIGSPREADRIWREMCKRRIHYDVV 305 >ref|XP_003553325.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15010, mitochondrial-like [Glycine max] Length = 516 Score = 127 bits (318), Expect = 1e-27 Identities = 56/86 (65%), Positives = 68/86 (79%) Frame = +1 Query: 1 NTFYALKRFKFEIGIAEFQDLLSALCRYKNVQDAEHLLFCNEKVFPLNTKSLNIILNGWC 180 NTFYA K+F F++G+ EF LLSALCRYKNVQDAEHLLFCN+ +FPL+TKS NIILNGWC Sbjct: 155 NTFYAYKQFNFQVGLEEFHSLLSALCRYKNVQDAEHLLFCNKNLFPLDTKSFNIILNGWC 214 Query: 181 NMIVNLREAKRFWRLMGRKGIARDTV 258 N+IV+ A+R W M ++ I D V Sbjct: 215 NLIVSTSHAERIWHEMSKRRIQHDVV 240