BLASTX nr result
ID: Cimicifuga21_contig00039080
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00039080 (270 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAU03490.1| trehalose-phosphate phosphatase [Nicotiana tabacum] 61 1e-07 gb|AEI55390.1| trehalose-6-phosphate phosphatase [Petunia x hybr... 61 1e-07 dbj|BAI99253.1| trehalose 6-phosphate phosphatase [Nicotiana tab... 61 1e-07 ref|XP_002510945.1| trehalose-6-phosphate synthase, putative [Ri... 60 1e-07 ref|XP_002265679.2| PREDICTED: uncharacterized glycosyl hydrolas... 58 7e-07 >gb|AAU03490.1| trehalose-phosphate phosphatase [Nicotiana tabacum] Length = 384 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -3 Query: 268 LVSSVPKESNAFYSLKDPSEVMEFLKCLVRWNTS 167 LVSS PKES+AFYSL+DPSEVMEFLKCLV W S Sbjct: 346 LVSSAPKESSAFYSLRDPSEVMEFLKCLVSWKKS 379 >gb|AEI55390.1| trehalose-6-phosphate phosphatase [Petunia x hybrida] Length = 368 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -3 Query: 268 LVSSVPKESNAFYSLKDPSEVMEFLKCLVRWNTS 167 LVSS PKES+AFYSL+DPSEVMEFLKCLV W S Sbjct: 330 LVSSAPKESSAFYSLRDPSEVMEFLKCLVAWKKS 363 >dbj|BAI99253.1| trehalose 6-phosphate phosphatase [Nicotiana tabacum] Length = 384 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -3 Query: 268 LVSSVPKESNAFYSLKDPSEVMEFLKCLVRWNTS 167 LVSS PKES+AFYSL+DPSEVMEFLKCLV W S Sbjct: 346 LVSSAPKESSAFYSLRDPSEVMEFLKCLVSWKKS 379 >ref|XP_002510945.1| trehalose-6-phosphate synthase, putative [Ricinus communis] gi|223550060|gb|EEF51547.1| trehalose-6-phosphate synthase, putative [Ricinus communis] Length = 386 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -3 Query: 268 LVSSVPKESNAFYSLKDPSEVMEFLKCLVRWNTS 167 LVSSVPKESNAFYSL+DPSEVMEFLK LV W S Sbjct: 350 LVSSVPKESNAFYSLRDPSEVMEFLKSLVMWKKS 383 >ref|XP_002265679.2| PREDICTED: uncharacterized glycosyl hydrolase Rv2006/MT2062 [Vitis vinifera] Length = 373 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -3 Query: 268 LVSSVPKESNAFYSLKDPSEVMEFLKCLVRWNTS 167 LVSSVPKESNAFYSL+DP EVMEFLK LV W S Sbjct: 337 LVSSVPKESNAFYSLRDPLEVMEFLKLLVMWKKS 370