BLASTX nr result
ID: Cimicifuga21_contig00038946
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00038946 (294 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283264.1| PREDICTED: protein FIZZY-RELATED 3 [Vitis vi... 74 5e-12 emb|CAN74903.1| hypothetical protein VITISV_042043 [Vitis vinifera] 74 1e-11 ref|XP_002531570.1| WD-repeat protein, putative [Ricinus communi... 71 2e-11 ref|NP_196888.2| protein FIZZY-related 3 [Arabidopsis thaliana] ... 69 9e-11 ref|XP_002873630.1| WD-40 repeat family protein [Arabidopsis lyr... 68 9e-11 >ref|XP_002283264.1| PREDICTED: protein FIZZY-RELATED 3 [Vitis vinifera] gi|296086214|emb|CBI31655.3| unnamed protein product [Vitis vinifera] Length = 471 Score = 74.3 bits (181), Expect(2) = 5e-12 Identities = 45/94 (47%), Positives = 51/94 (54%) Frame = +3 Query: 12 TVRGSEPWSSRILASGRRDRNILQYDLRVSNDFINKLVGHKYEKKTLQFVSVLVQTSMHM 191 T G WSSRIL+SG RDRNILQ+DLRVSNDF++KLVGHK E Sbjct: 248 TRTGVLAWSSRILSSGSRDRNILQHDLRVSNDFVSKLVGHKSE----------------- 290 Query: 192 YISTHTRGNDRIHHFFGLMCGLKWSHDDDKELAS 293 +CGLKWSH DD+ELAS Sbjct: 291 ------------------VCGLKWSH-DDRELAS 305 Score = 21.2 bits (43), Expect(2) = 5e-12 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = +2 Query: 2 DGVHCKRIRTL 34 DG CK++RT+ Sbjct: 233 DGTQCKKVRTM 243 >emb|CAN74903.1| hypothetical protein VITISV_042043 [Vitis vinifera] Length = 456 Score = 74.3 bits (181), Expect = 1e-11 Identities = 45/94 (47%), Positives = 51/94 (54%) Frame = +3 Query: 12 TVRGSEPWSSRILASGRRDRNILQYDLRVSNDFINKLVGHKYEKKTLQFVSVLVQTSMHM 191 T G WSSRIL+SG RDRNILQ+DLRVSNDF++KLVGHK E Sbjct: 249 TRTGVLAWSSRILSSGSRDRNILQHDLRVSNDFVSKLVGHKSE----------------- 291 Query: 192 YISTHTRGNDRIHHFFGLMCGLKWSHDDDKELAS 293 +CGLKWSH DD+ELAS Sbjct: 292 ------------------VCGLKWSH-DDRELAS 306 >ref|XP_002531570.1| WD-repeat protein, putative [Ricinus communis] gi|223528800|gb|EEF30806.1| WD-repeat protein, putative [Ricinus communis] Length = 493 Score = 71.2 bits (173), Expect(2) = 2e-11 Identities = 43/94 (45%), Positives = 51/94 (54%) Frame = +3 Query: 12 TVRGSEPWSSRILASGRRDRNILQYDLRVSNDFINKLVGHKYEKKTLQFVSVLVQTSMHM 191 T G W+SRIL+SG RDRNILQ+DLRVS+DF++KLVGHK E Sbjct: 270 TRTGVLAWNSRILSSGSRDRNILQHDLRVSSDFVSKLVGHKSE----------------- 312 Query: 192 YISTHTRGNDRIHHFFGLMCGLKWSHDDDKELAS 293 +CGLKWSH DD+ELAS Sbjct: 313 ------------------VCGLKWSH-DDRELAS 327 Score = 22.3 bits (46), Expect(2) = 2e-11 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +2 Query: 2 DGVHCKRIRTL 34 DG CKR+RT+ Sbjct: 255 DGTQCKRVRTM 265 >ref|NP_196888.2| protein FIZZY-related 3 [Arabidopsis thaliana] gi|334187668|ref|NP_001190305.1| protein FIZZY-related 3 [Arabidopsis thaliana] gi|75330295|sp|Q8LPL5.1|FZR3_ARATH RecName: Full=Protein FIZZY-RELATED 3; AltName: Full=Cell cycle switch protein CCS52B gi|20466231|gb|AAM20433.1| cell cycle switch protein [Arabidopsis thaliana] gi|25084105|gb|AAN72176.1| cell cycle switch protein [Arabidopsis thaliana] gi|332004565|gb|AED91948.1| protein FIZZY-related 3 [Arabidopsis thaliana] gi|332004566|gb|AED91949.1| protein FIZZY-related 3 [Arabidopsis thaliana] Length = 481 Score = 68.9 bits (167), Expect(2) = 9e-11 Identities = 41/94 (43%), Positives = 50/94 (53%) Frame = +3 Query: 12 TVRGSEPWSSRILASGRRDRNILQYDLRVSNDFINKLVGHKYEKKTLQFVSVLVQTSMHM 191 T G W+SRIL+SG RDRNILQ+D+RV +DF++KLVGHK E Sbjct: 258 TRTGVLAWNSRILSSGSRDRNILQHDIRVQSDFVSKLVGHKSE----------------- 300 Query: 192 YISTHTRGNDRIHHFFGLMCGLKWSHDDDKELAS 293 +CGLKWSH DD+ELAS Sbjct: 301 ------------------VCGLKWSH-DDRELAS 315 Score = 22.3 bits (46), Expect(2) = 9e-11 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +2 Query: 2 DGVHCKRIRTL 34 DG CKR+RT+ Sbjct: 243 DGTQCKRVRTM 253 >ref|XP_002873630.1| WD-40 repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297319467|gb|EFH49889.1| WD-40 repeat family protein [Arabidopsis lyrata subsp. lyrata] Length = 481 Score = 67.8 bits (164), Expect(2) = 9e-11 Identities = 40/94 (42%), Positives = 50/94 (53%) Frame = +3 Query: 12 TVRGSEPWSSRILASGRRDRNILQYDLRVSNDFINKLVGHKYEKKTLQFVSVLVQTSMHM 191 T G W+SRIL+SG RDRNILQ+D+RV +D+++KLVGHK E Sbjct: 258 TRTGVLAWNSRILSSGSRDRNILQHDIRVQSDYVSKLVGHKSE----------------- 300 Query: 192 YISTHTRGNDRIHHFFGLMCGLKWSHDDDKELAS 293 +CGLKWSH DD+ELAS Sbjct: 301 ------------------VCGLKWSH-DDRELAS 315 Score = 23.5 bits (49), Expect(2) = 9e-11 Identities = 7/11 (63%), Positives = 10/11 (90%) Frame = +2 Query: 2 DGVHCKRIRTL 34 DG+ CKR+RT+ Sbjct: 243 DGIQCKRVRTM 253