BLASTX nr result
ID: Cimicifuga21_contig00038445
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00038445 (315 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522229.1| conserved hypothetical protein [Ricinus comm... 62 6e-08 ref|XP_002265875.2| PREDICTED: DUF246 domain-containing protein ... 61 1e-07 emb|CBI30704.3| unnamed protein product [Vitis vinifera] 61 1e-07 gb|ACD56665.1| putative growth regulator [Gossypium arboreum] 59 5e-07 gb|AAT64018.1| putative growth regulator [Gossypium hirsutum] 59 5e-07 >ref|XP_002522229.1| conserved hypothetical protein [Ricinus communis] gi|223538482|gb|EEF40087.1| conserved hypothetical protein [Ricinus communis] Length = 598 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +1 Query: 1 MIEEGQRVRVRAIGRSIYRHPRCPECMCKGQ 93 MIEEGQRVRVR IGRSIYR PRCP+CMCK Q Sbjct: 568 MIEEGQRVRVRGIGRSIYRQPRCPDCMCKYQ 598 >ref|XP_002265875.2| PREDICTED: DUF246 domain-containing protein At1g04910-like [Vitis vinifera] Length = 628 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +1 Query: 1 MIEEGQRVRVRAIGRSIYRHPRCPECMCKGQ*H 99 MIEEGQRVRVR GRSIYR PRCP+CMCK H Sbjct: 596 MIEEGQRVRVRGFGRSIYRQPRCPQCMCKSHLH 628 >emb|CBI30704.3| unnamed protein product [Vitis vinifera] Length = 629 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +1 Query: 1 MIEEGQRVRVRAIGRSIYRHPRCPECMCKGQ*H 99 MIEEGQRVRVR GRSIYR PRCP+CMCK H Sbjct: 597 MIEEGQRVRVRGFGRSIYRQPRCPQCMCKSHLH 629 >gb|ACD56665.1| putative growth regulator [Gossypium arboreum] Length = 599 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = +1 Query: 1 MIEEGQRVRVRAIGRSIYRHPRCPECMCK 87 MIEEGQRVRVR GRSIYR PRCPECMC+ Sbjct: 570 MIEEGQRVRVRGSGRSIYRQPRCPECMCR 598 >gb|AAT64018.1| putative growth regulator [Gossypium hirsutum] Length = 599 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = +1 Query: 1 MIEEGQRVRVRAIGRSIYRHPRCPECMCK 87 MIEEGQRVRVR GRSIYR PRCPECMC+ Sbjct: 570 MIEEGQRVRVRGSGRSIYRQPRCPECMCR 598