BLASTX nr result
ID: Cimicifuga21_contig00038433
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00038433 (256 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003608278.1| Pentatricopeptide repeat-containing protein ... 88 8e-16 ref|XP_002279589.1| PREDICTED: pentatricopeptide repeat-containi... 82 5e-14 ref|XP_003530995.1| PREDICTED: pentatricopeptide repeat-containi... 82 6e-14 ref|XP_002527150.1| pentatricopeptide repeat-containing protein,... 80 1e-13 ref|XP_002328265.1| predicted protein [Populus trichocarpa] gi|2... 77 2e-12 >ref|XP_003608278.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|124359684|gb|ABD32353.2| Tetratricopeptide-like helical [Medicago truncatula] gi|355509333|gb|AES90475.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 870 Score = 87.8 bits (216), Expect = 8e-16 Identities = 40/57 (70%), Positives = 48/57 (84%) Frame = -1 Query: 211 KGDGIFTNLENYNTWLLGLVRNKKLLKARSVLQEMIEKGINPNIYSYNILIDGLCRS 41 K G F +LE+YNTWLLGL+RN KLL+ RSVL EM+E GI PNIYSYNI++DGLCR+ Sbjct: 320 KKGGNFVSLESYNTWLLGLLRNGKLLEGRSVLDEMVENGIEPNIYSYNIVMDGLCRN 376 >ref|XP_002279589.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140 [Vitis vinifera] gi|297744485|emb|CBI37747.3| unnamed protein product [Vitis vinifera] Length = 878 Score = 82.0 bits (201), Expect = 5e-14 Identities = 37/63 (58%), Positives = 50/63 (79%) Frame = -1 Query: 211 KGDGIFTNLENYNTWLLGLVRNKKLLKARSVLQEMIEKGINPNIYSYNILIDGLCRSGYT 32 K +G LE+YN WLLGLVRN KLL+A+ L+EM++KGI PNIYS+N ++DGLC++G Sbjct: 322 KRNGNLMELESYNIWLLGLVRNGKLLEAQLALKEMVDKGIEPNIYSFNTVMDGLCKNGLI 381 Query: 31 SNA 23 S+A Sbjct: 382 SDA 384 >ref|XP_003530995.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140-like [Glycine max] Length = 875 Score = 81.6 bits (200), Expect = 6e-14 Identities = 38/63 (60%), Positives = 49/63 (77%) Frame = -1 Query: 202 GIFTNLENYNTWLLGLVRNKKLLKARSVLQEMIEKGINPNIYSYNILIDGLCRSGYTSNA 23 G F +LE YN WL+GL+RN +LL+AR VL EM+ KGI PN Y+YNI++DGLCR+ S+A Sbjct: 323 GNFDSLECYNIWLMGLLRNGELLEARLVLDEMVAKGIEPNAYTYNIMMDGLCRNHMLSDA 382 Query: 22 LGL 14 GL Sbjct: 383 RGL 385 >ref|XP_002527150.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223533489|gb|EEF35232.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 874 Score = 80.5 bits (197), Expect = 1e-13 Identities = 38/63 (60%), Positives = 50/63 (79%) Frame = -1 Query: 211 KGDGIFTNLENYNTWLLGLVRNKKLLKARSVLQEMIEKGINPNIYSYNILIDGLCRSGYT 32 K + F NLE+YN WLLGL+RN KLL+A VL+EM+ GI P+IYSYNI++DGLC++G Sbjct: 318 KRNANFINLESYNIWLLGLIRNGKLLEAWIVLKEMLGIGIEPDIYSYNIVMDGLCKNGML 377 Query: 31 SNA 23 S+A Sbjct: 378 SDA 380 >ref|XP_002328265.1| predicted protein [Populus trichocarpa] gi|222837780|gb|EEE76145.1| predicted protein [Populus trichocarpa] Length = 742 Score = 76.6 bits (187), Expect = 2e-12 Identities = 35/61 (57%), Positives = 48/61 (78%) Frame = -1 Query: 190 NLENYNTWLLGLVRNKKLLKARSVLQEMIEKGINPNIYSYNILIDGLCRSGYTSNALGLF 11 N E+YN WLLGLVR KLL+A+ VL+EM++ G+ PN+YSYNI++DGLC++G +A L Sbjct: 234 NRESYNIWLLGLVRIGKLLEAQLVLKEMVDMGMEPNVYSYNIVMDGLCKNGVLFDARMLM 293 Query: 10 R 8 R Sbjct: 294 R 294