BLASTX nr result
ID: Cimicifuga21_contig00037914
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00037914 (315 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI37206.3| unnamed protein product [Vitis vinifera] 154 7e-36 ref|XP_002269187.1| PREDICTED: pentatricopeptide repeat-containi... 154 7e-36 ref|XP_002528772.1| pentatricopeptide repeat-containing protein,... 153 1e-35 gb|AAF81338.1|AC007767_18 Contains similarity to a hypothetical ... 142 4e-32 ref|NP_564401.1| pentatricopeptide repeat-containing protein [Ar... 142 4e-32 >emb|CBI37206.3| unnamed protein product [Vitis vinifera] Length = 664 Score = 154 bits (389), Expect = 7e-36 Identities = 68/105 (64%), Positives = 88/105 (83%) Frame = +1 Query: 1 FSHHGHAKEALELFDIMQDTGTCPNSVTFLGVLSACSHAGMVDRGWELFNSMSPEYAVQP 180 FSHHG EAL++F+ M +GT PNSVTFLG+LSACSHAG++++GWELF++MS +A+QP Sbjct: 462 FSHHGLTSEALKVFEAMLTSGTHPNSVTFLGILSACSHAGLLNQGWELFDAMSDVFAIQP 521 Query: 181 GFEHYVSIIDLLGRAGKIEEAAEFVMRLPFEPGPIIWGALLGICG 315 EHYV +++LLGRAGK+EEA EF+ +LPFEP IWGALLG+CG Sbjct: 522 QLEHYVCMVNLLGRAGKVEEAEEFISKLPFEPDLTIWGALLGVCG 566 >ref|XP_002269187.1| PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Vitis vinifera] Length = 743 Score = 154 bits (389), Expect = 7e-36 Identities = 68/105 (64%), Positives = 88/105 (83%) Frame = +1 Query: 1 FSHHGHAKEALELFDIMQDTGTCPNSVTFLGVLSACSHAGMVDRGWELFNSMSPEYAVQP 180 FSHHG EAL++F+ M +GT PNSVTFLG+LSACSHAG++++GWELF++MS +A+QP Sbjct: 541 FSHHGLTSEALKVFEAMLTSGTHPNSVTFLGILSACSHAGLLNQGWELFDAMSDVFAIQP 600 Query: 181 GFEHYVSIIDLLGRAGKIEEAAEFVMRLPFEPGPIIWGALLGICG 315 EHYV +++LLGRAGK+EEA EF+ +LPFEP IWGALLG+CG Sbjct: 601 QLEHYVCMVNLLGRAGKVEEAEEFISKLPFEPDLTIWGALLGVCG 645 >ref|XP_002528772.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223531775|gb|EEF33594.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 676 Score = 153 bits (387), Expect = 1e-35 Identities = 68/104 (65%), Positives = 87/104 (83%) Frame = +1 Query: 1 FSHHGHAKEALELFDIMQDTGTCPNSVTFLGVLSACSHAGMVDRGWELFNSMSPEYAVQP 180 FSHHG A EALE+F+ M D+GT PNSVTFLGVLSACSHAG++++GWE+FN+MS +AVQP Sbjct: 475 FSHHGLANEALEVFEAMVDSGTHPNSVTFLGVLSACSHAGLINQGWEIFNAMSDVFAVQP 534 Query: 181 GFEHYVSIIDLLGRAGKIEEAAEFVMRLPFEPGPIIWGALLGIC 312 G EHY+ +++LLGRAGK++EA E ++ LP E IWGALLG+C Sbjct: 535 GLEHYICMVNLLGRAGKLKEAEELILGLPLERNHAIWGALLGVC 578 >gb|AAF81338.1|AC007767_18 Contains similarity to a hypothetical protein F19I3.26 gi|7485810 from Arabidopsis thaliana BAC F19I3 gb|AC004238. It contains a PPR repeat domain PF|01535. ESTs gb|AV539170, gb|AV551571, gb|AA597781, gb|AV544524, gb|AV531577 and gb|AV533492 come from this gene [Arabidopsis thaliana] Length = 864 Score = 142 bits (357), Expect = 4e-32 Identities = 65/104 (62%), Positives = 82/104 (78%) Frame = +1 Query: 4 SHHGHAKEALELFDIMQDTGTCPNSVTFLGVLSACSHAGMVDRGWELFNSMSPEYAVQPG 183 SHHG A +AL LF M D+G PNSVTFLGVLSACSH+G++ RG ELF +M Y++QPG Sbjct: 648 SHHGLADKALNLFKEMLDSGKKPNSVTFLGVLSACSHSGLITRGLELFKAMKETYSIQPG 707 Query: 184 FEHYVSIIDLLGRAGKIEEAAEFVMRLPFEPGPIIWGALLGICG 315 +HY+S+IDLLGRAGK++EA EF+ LPF P ++GALLG+CG Sbjct: 708 IDHYISMIDLLGRAGKLKEAEEFISALPFTPDHTVYGALLGLCG 751 >ref|NP_564401.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|193806407|sp|P0C7R0.1|PPR69_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g32415, mitochondrial; Flags: Precursor gi|332193363|gb|AEE31484.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 761 Score = 142 bits (357), Expect = 4e-32 Identities = 65/104 (62%), Positives = 82/104 (78%) Frame = +1 Query: 4 SHHGHAKEALELFDIMQDTGTCPNSVTFLGVLSACSHAGMVDRGWELFNSMSPEYAVQPG 183 SHHG A +AL LF M D+G PNSVTFLGVLSACSH+G++ RG ELF +M Y++QPG Sbjct: 545 SHHGLADKALNLFKEMLDSGKKPNSVTFLGVLSACSHSGLITRGLELFKAMKETYSIQPG 604 Query: 184 FEHYVSIIDLLGRAGKIEEAAEFVMRLPFEPGPIIWGALLGICG 315 +HY+S+IDLLGRAGK++EA EF+ LPF P ++GALLG+CG Sbjct: 605 IDHYISMIDLLGRAGKLKEAEEFISALPFTPDHTVYGALLGLCG 648