BLASTX nr result
ID: Cimicifuga21_contig00037534
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00037534 (280 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002317519.1| nbs-lrr resistance protein [Populus trichoca... 78 6e-13 ref|XP_002325713.1| nbs-lrr resistance protein [Populus trichoca... 77 1e-12 ref|XP_002333460.1| predicted protein [Populus trichocarpa] gi|2... 77 2e-12 ref|XP_002332782.1| BED finger-nbs-lrr resistance protein [Popul... 76 2e-12 ref|XP_002333268.1| predicted protein [Populus trichocarpa] gi|2... 76 3e-12 >ref|XP_002317519.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222860584|gb|EEE98131.1| nbs-lrr resistance protein [Populus trichocarpa] Length = 958 Score = 78.2 bits (191), Expect = 6e-13 Identities = 43/85 (50%), Positives = 50/85 (58%) Frame = +3 Query: 24 SPNCPGVRTLLLNGNPSLRHITHGLFVQMQGLRILNLRSTGIQFLPESISTLINLHVLDL 203 SP CP + TL LN N L I F +QGL++LNL ST I LP S S L+NL L L Sbjct: 483 SPMCPKLSTLFLNSNIELEMIADSFFKHLQGLKVLNLSSTAIPKLPGSFSDLVNLTALYL 542 Query: 204 SCCEKLKRVHSLEKLHSLRVLRLTY 278 CEKL+ + SL KL LR L L Y Sbjct: 543 RRCEKLRHIPSLAKLRELRKLDLRY 567 >ref|XP_002325713.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222862588|gb|EEF00095.1| nbs-lrr resistance protein [Populus trichocarpa] Length = 929 Score = 77.0 bits (188), Expect = 1e-12 Identities = 40/84 (47%), Positives = 56/84 (66%) Frame = +3 Query: 24 SPNCPGVRTLLLNGNPSLRHITHGLFVQMQGLRILNLRSTGIQFLPESISTLINLHVLDL 203 SP CP + TLLL GN L+ I F Q++GL++L+L TGI LP+S+S L++L L L Sbjct: 416 SPRCPSLSTLLLRGNSELQFIADSFFEQLRGLKVLDLSYTGITKLPDSVSELVSLTALLL 475 Query: 204 SCCEKLKRVHSLEKLHSLRVLRLT 275 C+ L+ V SLEKL +L+ L L+ Sbjct: 476 IDCKMLRHVPSLEKLRALKRLDLS 499 >ref|XP_002333460.1| predicted protein [Populus trichocarpa] gi|222836928|gb|EEE75321.1| predicted protein [Populus trichocarpa] Length = 503 Score = 76.6 bits (187), Expect = 2e-12 Identities = 43/85 (50%), Positives = 56/85 (65%) Frame = +3 Query: 24 SPNCPGVRTLLLNGNPSLRHITHGLFVQMQGLRILNLRSTGIQFLPESISTLINLHVLDL 203 SP CP + TLLL GNP L I F Q+ GL++L+L STGI L +S+S L+NL L + Sbjct: 58 SPKCPNLSTLLLCGNP-LVLIADSFFEQLHGLKVLDLSSTGITKLSDSVSELVNLTALLI 116 Query: 204 SCCEKLKRVHSLEKLHSLRVLRLTY 278 + C KL+ V SLEKL +L+ L L Y Sbjct: 117 NKCMKLRHVPSLEKLRALKRLELHY 141 >ref|XP_002332782.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] gi|222833191|gb|EEE71668.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] Length = 1214 Score = 76.3 bits (186), Expect = 2e-12 Identities = 42/84 (50%), Positives = 53/84 (63%) Frame = +3 Query: 24 SPNCPGVRTLLLNGNPSLRHITHGLFVQMQGLRILNLRSTGIQFLPESISTLINLHVLDL 203 SP CP + TLLL N LR I F Q+ GL++LNL TGIQ LP+S+S L++L L L Sbjct: 688 SPRCPYLSTLLLCQNRWLRFIADSFFKQLHGLKVLNLAGTGIQNLPDSVSDLVSLTALLL 747 Query: 204 SCCEKLKRVHSLEKLHSLRVLRLT 275 CE L+ V S EKL L+ L L+ Sbjct: 748 KGCENLRHVPSFEKLGELKRLDLS 771 >ref|XP_002333268.1| predicted protein [Populus trichocarpa] gi|222835869|gb|EEE74290.1| predicted protein [Populus trichocarpa] Length = 877 Score = 75.9 bits (185), Expect = 3e-12 Identities = 40/84 (47%), Positives = 55/84 (65%) Frame = +3 Query: 24 SPNCPGVRTLLLNGNPSLRHITHGLFVQMQGLRILNLRSTGIQFLPESISTLINLHVLDL 203 SP CP + TLLL GN L+ I F Q++GL++L+L TGI LP+S+S L++L L L Sbjct: 369 SPRCPSLSTLLLRGNSELQFIADSFFEQLRGLKVLDLSYTGITKLPDSVSELVSLTALLL 428 Query: 204 SCCEKLKRVHSLEKLHSLRVLRLT 275 C+ L+ V SLEKL L+ L L+ Sbjct: 429 IGCKMLRHVPSLEKLRVLKRLDLS 452