BLASTX nr result
ID: Cimicifuga21_contig00037251
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00037251 (260 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523685.1| hypothetical protein RCOM_1272620 [Ricinus c... 65 4e-09 ref|XP_002278583.1| PREDICTED: uncharacterized protein LOC100249... 64 1e-08 >ref|XP_002523685.1| hypothetical protein RCOM_1272620 [Ricinus communis] gi|223537085|gb|EEF38720.1| hypothetical protein RCOM_1272620 [Ricinus communis] Length = 341 Score = 65.5 bits (158), Expect = 4e-09 Identities = 31/62 (50%), Positives = 41/62 (66%), Gaps = 2/62 (3%) Frame = -2 Query: 181 ESPLLKSSSTRKTT--KENNQSQNIGCMSGIFHFISKYHQRRKFLTSGEKKDKKVNSVPA 8 + P L SSS R+ + EN +++NIGCMSGIF + KYH RR+FLTSG K +K N + Sbjct: 4 QDPTLSSSSRREISPASENARAKNIGCMSGIFQLVCKYHNRRRFLTSGRKHEKNANVANS 63 Query: 7 GP 2 P Sbjct: 64 SP 65 >ref|XP_002278583.1| PREDICTED: uncharacterized protein LOC100249911 [Vitis vinifera] gi|297741721|emb|CBI32853.3| unnamed protein product [Vitis vinifera] Length = 355 Score = 63.9 bits (154), Expect = 1e-08 Identities = 32/60 (53%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Frame = -2 Query: 187 RAESPLLKSSSTRKTTKENNQS-QNIGCMSGIFHFISKYHQRRKFLTSGEKKDKKVNSVP 11 + + LL SSS R+ EN+ + + IGCMSGIFHF+ KY +RRKFLT G K DK S P Sbjct: 2 KRQDTLLSSSSRREAMPENHHAAKTIGCMSGIFHFVCKYQRRRKFLTFGRKHDKNEASSP 61