BLASTX nr result
ID: Cimicifuga21_contig00037092
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00037092 (292 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_064095.1| orf105b gene product (mitochondrion) [Beta vulg... 114 1e-26 >ref|NP_064095.1| orf105b gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435118|ref|YP_004222336.1| hypothetical protein BevumaM_p102 [Beta vulgaris subsp. maritima] gi|346683210|ref|YP_004842142.1| hypothetical protein BemaM_p098 [Beta macrocarpa] gi|9087344|dbj|BAA99488.1| orf105b [Beta vulgaris subsp. vulgaris] gi|317905672|emb|CBJ14067.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439851|emb|CBJ17557.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|320148061|emb|CBJ20724.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500128|emb|CBX24947.1| hypothetical protein [Beta macrocarpa] gi|384939126|emb|CBL51972.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 105 Score = 114 bits (285), Expect(2) = 1e-26 Identities = 57/66 (86%), Positives = 60/66 (90%) Frame = -2 Query: 288 RAGLSRVRGPIRSTSDRFTEQGVKQGPGD*WKNLAEVSVVFHSAGWLVGKIAFCRLSFPS 109 RAGLSRVR PIRSTSDRFTEQGVKQGPG WKNLAEVS+VF+SAGWLVG+IAFC LSF S Sbjct: 11 RAGLSRVRSPIRSTSDRFTEQGVKQGPGYLWKNLAEVSIVFNSAGWLVGRIAFCHLSFLS 70 Query: 108 LSYLSK 91 LS LSK Sbjct: 71 LSSLSK 76 Score = 30.4 bits (67), Expect(2) = 1e-26 Identities = 19/28 (67%), Positives = 22/28 (78%), Gaps = 2/28 (7%) Frame = -1 Query: 88 RFKSHFLLATSWAQ--GLQSAASPVVVS 11 R KS+F LATSWA+ GL+ ASPVVVS Sbjct: 79 RKKSNFWLATSWARVSGLEK-ASPVVVS 105