BLASTX nr result
ID: Cimicifuga21_contig00036278
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00036278 (418 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004134418.1| PREDICTED: putative SWI/SNF-related matrix-a... 63 2e-08 >ref|XP_004134418.1| PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 3-like [Cucumis sativus] gi|449523563|ref|XP_004168793.1| PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 3-like [Cucumis sativus] Length = 1113 Score = 63.2 bits (152), Expect = 2e-08 Identities = 34/68 (50%), Positives = 47/68 (69%), Gaps = 2/68 (2%) Frame = -2 Query: 393 EKIAKVRSFPGIDFPEADILRALSISGNDTDEAIRILLETP-LLVDPMTTVKR-TSTGAR 220 EK+ K+RS G+DFP++ I R LS +G D DEAI+ +LE P L P++ V+ TSTGAR Sbjct: 9 EKLKKIRSVVGLDFPDSFIHRTLSRNGGDPDEAIKYILENPGFLARPLSVVRTVTSTGAR 68 Query: 219 ISAQIKQE 196 +S Q Q+ Sbjct: 69 VSTQFMQK 76