BLASTX nr result
ID: Cimicifuga21_contig00035972
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00035972 (236 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002310900.1| histone acetyltransferase [Populus trichocar... 76 2e-12 gb|AEL98868.1| E1A/CREB-binding protein, partial [Silene latifolia] 76 3e-12 gb|AEL98867.1| E1A/CREB-binding protein, partial [Silene latifolia] 76 3e-12 ref|XP_002513288.1| transcription cofactor, putative [Ricinus co... 75 6e-12 ref|XP_003632923.1| PREDICTED: histone acetyltransferase HAC1-li... 74 1e-11 >ref|XP_002310900.1| histone acetyltransferase [Populus trichocarpa] gi|222853803|gb|EEE91350.1| histone acetyltransferase [Populus trichocarpa] Length = 1719 Score = 76.3 bits (186), Expect = 2e-12 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = +2 Query: 89 KDQNIGELSKMLDLQVHGSQCRLQRCPYPNCRNLKGLFRHGIQCRTRAS 235 + Q + +L KMLDL VH SQCR C YPNCR +KGLFRHGIQC+TRAS Sbjct: 1603 RQQRVLQLRKMLDLLVHASQCRSPHCQYPNCRKVKGLFRHGIQCKTRAS 1651 >gb|AEL98868.1| E1A/CREB-binding protein, partial [Silene latifolia] Length = 251 Score = 75.9 bits (185), Expect = 3e-12 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = +2 Query: 89 KDQNIGELSKMLDLQVHGSQCRLQRCPYPNCRNLKGLFRHGIQCRTRAS 235 + Q + +L KML+L VH SQCR C YPNCR +KGLFRHGIQCRTRAS Sbjct: 136 RQQRVVQLRKMLELLVHASQCRSPTCQYPNCRKVKGLFRHGIQCRTRAS 184 >gb|AEL98867.1| E1A/CREB-binding protein, partial [Silene latifolia] Length = 251 Score = 75.9 bits (185), Expect = 3e-12 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = +2 Query: 89 KDQNIGELSKMLDLQVHGSQCRLQRCPYPNCRNLKGLFRHGIQCRTRAS 235 + Q + +L KML+L VH SQCR C YPNCR +KGLFRHGIQCRTRAS Sbjct: 136 RQQRVVQLRKMLELLVHASQCRSPTCQYPNCRKVKGLFRHGIQCRTRAS 184 >ref|XP_002513288.1| transcription cofactor, putative [Ricinus communis] gi|223547196|gb|EEF48691.1| transcription cofactor, putative [Ricinus communis] Length = 1720 Score = 75.1 bits (183), Expect = 6e-12 Identities = 32/49 (65%), Positives = 38/49 (77%) Frame = +2 Query: 89 KDQNIGELSKMLDLQVHGSQCRLQRCPYPNCRNLKGLFRHGIQCRTRAS 235 + Q + +L +MLDL VH SQCR C YPNCR +KGLFRHGIQC+TRAS Sbjct: 1604 RQQRVLQLRRMLDLLVHASQCRSPHCQYPNCRKVKGLFRHGIQCKTRAS 1652 >ref|XP_003632923.1| PREDICTED: histone acetyltransferase HAC1-like isoform 2 [Vitis vinifera] Length = 1658 Score = 73.9 bits (180), Expect = 1e-11 Identities = 32/43 (74%), Positives = 35/43 (81%) Frame = +2 Query: 107 ELSKMLDLQVHGSQCRLQRCPYPNCRNLKGLFRHGIQCRTRAS 235 +L KMLDL VH SQCR C YPNCR +KGLFRHGIQC+TRAS Sbjct: 1548 QLRKMLDLLVHASQCRSPHCQYPNCRKVKGLFRHGIQCKTRAS 1590