BLASTX nr result
ID: Cimicifuga21_contig00035944
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00035944 (254 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003637626.1| Pentatricopeptide repeat-containing protein ... 56 3e-06 ref|XP_003637381.1| Pentatricopeptide repeat-containing protein ... 56 3e-06 >ref|XP_003637626.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355503561|gb|AES84764.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 989 Score = 56.2 bits (134), Expect = 3e-06 Identities = 31/63 (49%), Positives = 36/63 (57%), Gaps = 1/63 (1%) Frame = +2 Query: 65 PTSLNKG-SNLEHKPQLKIPPLKAHLYASLFCTLIQAYLNCSRFSDAIEAFFSMRNHGLN 241 PT + + S+ HK + IPP K HLY S FCTLI+ YL RFS A F MR GL Sbjct: 32 PTPITRTFSSQIHKDSIFIPPTKTHLYVSFFCTLIRLYLTHDRFSTASATFSHMRALGLV 91 Query: 242 PNL 250 P L Sbjct: 92 PTL 94 >ref|XP_003637381.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355503316|gb|AES84519.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 1023 Score = 56.2 bits (134), Expect = 3e-06 Identities = 31/63 (49%), Positives = 36/63 (57%), Gaps = 1/63 (1%) Frame = +2 Query: 65 PTSLNKG-SNLEHKPQLKIPPLKAHLYASLFCTLIQAYLNCSRFSDAIEAFFSMRNHGLN 241 PT + + S+ HK + IPP K HLY S FCTLI+ YL RFS A F MR GL Sbjct: 32 PTPITRTFSSQIHKDSIFIPPTKTHLYVSFFCTLIRLYLTHDRFSTASATFSHMRALGLV 91 Query: 242 PNL 250 P L Sbjct: 92 PTL 94