BLASTX nr result
ID: Cimicifuga21_contig00035434
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00035434 (261 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004149831.1| PREDICTED: pentatricopeptide repeat-containi... 66 3e-09 ref|XP_002279168.1| PREDICTED: pentatricopeptide repeat-containi... 61 1e-07 emb|CBI15606.3| unnamed protein product [Vitis vinifera] 61 1e-07 gb|AAG29200.1|AC078898_10 hypothetical protein [Arabidopsis thal... 60 2e-07 ref|NP_177865.2| pentatricopeptide repeat-containing protein [Ar... 60 2e-07 >ref|XP_004149831.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405-like [Cucumis sativus] gi|449518241|ref|XP_004166151.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405-like [Cucumis sativus] Length = 445 Score = 65.9 bits (159), Expect = 3e-09 Identities = 34/56 (60%), Positives = 44/56 (78%), Gaps = 3/56 (5%) Frame = -3 Query: 163 LVKQVLTAILQNRSFDT---SLATSSASPQLWTVHTVSEVLRSIPRFFFQSNRSIG 5 LV Q+L A+L+NR FDT S A++S + QLW+ +VS+VLRS+PRFFFQS RSIG Sbjct: 14 LVDQILVAMLKNRPFDTHVHSAASTSTTHQLWSSDSVSDVLRSVPRFFFQSARSIG 69 >ref|XP_002279168.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405-like [Vitis vinifera] Length = 432 Score = 60.8 bits (146), Expect = 1e-07 Identities = 35/56 (62%), Positives = 38/56 (67%) Frame = -3 Query: 169 SPLVKQVLTAILQNRSFDTSLATSSASPQLWTVHTVSEVLRSIPRFFFQSNRSIGR 2 S LVKQVL A++QN D S S P WT +VSEVLRSIPR FFQS RSIGR Sbjct: 12 SSLVKQVLAAMVQNCPLDASPNKSCNQP--WTTDSVSEVLRSIPRLFFQSPRSIGR 65 >emb|CBI15606.3| unnamed protein product [Vitis vinifera] Length = 381 Score = 60.8 bits (146), Expect = 1e-07 Identities = 35/56 (62%), Positives = 38/56 (67%) Frame = -3 Query: 169 SPLVKQVLTAILQNRSFDTSLATSSASPQLWTVHTVSEVLRSIPRFFFQSNRSIGR 2 S LVKQVL A++QN D S S P WT +VSEVLRSIPR FFQS RSIGR Sbjct: 12 SSLVKQVLAAMVQNCPLDASPNKSCNQP--WTTDSVSEVLRSIPRLFFQSPRSIGR 65 >gb|AAG29200.1|AC078898_10 hypothetical protein [Arabidopsis thaliana] Length = 410 Score = 59.7 bits (143), Expect = 2e-07 Identities = 31/54 (57%), Positives = 40/54 (74%) Frame = -3 Query: 163 LVKQVLTAILQNRSFDTSLATSSASPQLWTVHTVSEVLRSIPRFFFQSNRSIGR 2 +V Q++TA++QNR FD LA+S+ + WT VS+VL SIPRFFF S RSIGR Sbjct: 11 IVDQLITAMIQNRPFDAVLASSTVAKP-WTQQLVSDVLHSIPRFFFISPRSIGR 63 >ref|NP_177865.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|122244095|sp|Q1PFC5.1|PP130_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g77405 gi|91806103|gb|ABE65780.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332197853|gb|AEE35974.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 458 Score = 59.7 bits (143), Expect = 2e-07 Identities = 31/54 (57%), Positives = 40/54 (74%) Frame = -3 Query: 163 LVKQVLTAILQNRSFDTSLATSSASPQLWTVHTVSEVLRSIPRFFFQSNRSIGR 2 +V Q++TA++QNR FD LA+S+ + WT VS+VL SIPRFFF S RSIGR Sbjct: 11 IVDQLITAMIQNRPFDAVLASSTVAKP-WTQQLVSDVLHSIPRFFFISPRSIGR 63