BLASTX nr result
ID: Cimicifuga21_contig00034625
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00034625 (328 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530118.1| ubiquitin-protein ligase, putative [Ricinus ... 73 3e-11 dbj|BAB08822.1| unnamed protein product [Arabidopsis thaliana] 66 3e-09 ref|XP_002303718.1| predicted protein [Populus trichocarpa] gi|2... 65 7e-09 gb|ABK92731.1| unknown [Populus trichocarpa] 65 7e-09 ref|XP_003547403.1| PREDICTED: uncharacterized protein LOC100796... 61 8e-08 >ref|XP_002530118.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223530372|gb|EEF32262.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 740 Score = 72.8 bits (177), Expect = 3e-11 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -2 Query: 327 MCTCFKCAHELQWSSSRCPICRAPILDVVRAYSD 226 MCTC KCAHELQWSS +CPICRAPILDVVRAY D Sbjct: 706 MCTCLKCAHELQWSSGKCPICRAPILDVVRAYMD 739 >dbj|BAB08822.1| unnamed protein product [Arabidopsis thaliana] Length = 684 Score = 65.9 bits (159), Expect = 3e-09 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -2 Query: 327 MCTCFKCAHELQWSSSRCPICRAPILDVVRAYSD 226 MCTC KCAHELQWS+ +CPIC API+DVVRA+ D Sbjct: 650 MCTCLKCAHELQWSNMKCPICMAPIVDVVRAFLD 683 >ref|XP_002303718.1| predicted protein [Populus trichocarpa] gi|222841150|gb|EEE78697.1| predicted protein [Populus trichocarpa] Length = 816 Score = 64.7 bits (156), Expect = 7e-09 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -2 Query: 327 MCTCFKCAHELQWSSSRCPICRAPILDVVRAYSD 226 MCTC KCAHEL SS +CPICRAPILDVVRAY D Sbjct: 782 MCTCLKCAHELLQSSGKCPICRAPILDVVRAYLD 815 >gb|ABK92731.1| unknown [Populus trichocarpa] Length = 116 Score = 64.7 bits (156), Expect = 7e-09 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -2 Query: 327 MCTCFKCAHELQWSSSRCPICRAPILDVVRAYSD 226 MCTC KCAHEL SS +CPICRAPILDVVRAY D Sbjct: 82 MCTCLKCAHELLQSSGKCPICRAPILDVVRAYLD 115 >ref|XP_003547403.1| PREDICTED: uncharacterized protein LOC100796627 [Glycine max] Length = 917 Score = 61.2 bits (147), Expect = 8e-08 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -2 Query: 327 MCTCFKCAHELQWSSSRCPICRAPILDVVRAYSD 226 MCTC KCA+ELQW+S +CPICRA I DVVR Y D Sbjct: 883 MCTCLKCANELQWNSGKCPICRAKIEDVVRVYVD 916