BLASTX nr result
ID: Cimicifuga21_contig00031422
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00031422 (293 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267486.1| PREDICTED: putative pentatricopeptide repeat... 83 3e-14 ref|XP_004158095.1| PREDICTED: putative pentatricopeptide repeat... 77 2e-12 ref|XP_004135727.1| PREDICTED: putative pentatricopeptide repeat... 77 2e-12 ref|XP_003554875.1| PREDICTED: uncharacterized protein LOC100816... 68 7e-10 ref|XP_003621961.1| Pentatricopeptide repeat-containing protein ... 64 2e-08 >ref|XP_002267486.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Vitis vinifera] gi|297735747|emb|CBI18434.3| unnamed protein product [Vitis vinifera] Length = 659 Score = 82.8 bits (203), Expect = 3e-14 Identities = 43/88 (48%), Positives = 55/88 (62%) Frame = -3 Query: 264 TLSSYFIKSGVLPRVVDIYNDILNRGLEPDGYSYAGLLSALCNAGKFDYAVKLYQGIVRN 85 +L SYF K+G V+ YND+L+RG D YS+ GLLS LC +G+ D AV +Y GI+ N Sbjct: 404 SLLSYFCKAGFPSLAVEFYNDMLDRGFMIDQYSFVGLLSGLCGSGRVDEAVNVYSGILVN 463 Query: 84 SLCFDAHITTVMADELIKVGKCQAAITL 1 DAHI TV+ LIK GK A+ L Sbjct: 464 HSDLDAHIHTVIIGGLIKAGKFHRAVRL 491 >ref|XP_004158095.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830-like [Cucumis sativus] Length = 525 Score = 76.6 bits (187), Expect = 2e-12 Identities = 39/88 (44%), Positives = 56/88 (63%) Frame = -3 Query: 264 TLSSYFIKSGVLPRVVDIYNDILNRGLEPDGYSYAGLLSALCNAGKFDYAVKLYQGIVRN 85 +L SY K+G +++YN+++N GL PD YS G+L+ LC + + AV+LY GI+ N Sbjct: 317 SLLSYLGKAGFAALALELYNNMVNGGLMPDKYSVLGVLTGLCESRRIGEAVRLYNGILLN 376 Query: 84 SLCFDAHITTVMADELIKVGKCQAAITL 1 DAHI TV+ D LIK GK +AI + Sbjct: 377 YTGVDAHIHTVIIDGLIKAGKFHSAIRI 404 >ref|XP_004135727.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830-like [Cucumis sativus] Length = 665 Score = 76.6 bits (187), Expect = 2e-12 Identities = 39/88 (44%), Positives = 56/88 (63%) Frame = -3 Query: 264 TLSSYFIKSGVLPRVVDIYNDILNRGLEPDGYSYAGLLSALCNAGKFDYAVKLYQGIVRN 85 +L SY K+G +++YN+++N GL PD YS G+L+ LC + + AV+LY GI+ N Sbjct: 409 SLLSYLGKAGFAALALELYNNMVNGGLMPDKYSVLGVLTGLCESRRIGEAVRLYNGILLN 468 Query: 84 SLCFDAHITTVMADELIKVGKCQAAITL 1 DAHI TV+ D LIK GK +AI + Sbjct: 469 YTGVDAHIHTVIIDGLIKAGKFHSAIRI 496 >ref|XP_003554875.1| PREDICTED: uncharacterized protein LOC100816100 [Glycine max] Length = 1122 Score = 68.2 bits (165), Expect = 7e-10 Identities = 36/87 (41%), Positives = 53/87 (60%) Frame = -3 Query: 261 LSSYFIKSGVLPRVVDIYNDILNRGLEPDGYSYAGLLSALCNAGKFDYAVKLYQGIVRNS 82 L S K+ + V Y+ +++ G PD Y++AGLLSALC AG+ D AV +Y G+V + Sbjct: 391 LLSSLTKADLPSLAVGFYDHMIDEGFVPDKYTFAGLLSALCCAGRVDKAVNVYHGVVMSY 450 Query: 81 LCFDAHITTVMADELIKVGKCQAAITL 1 DAHI TV+ L+K GK A+++ Sbjct: 451 HDTDAHIHTVIIVGLLKTGKFHKAVSV 477 >ref|XP_003621961.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355496976|gb|AES78179.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 646 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/80 (37%), Positives = 53/80 (66%) Frame = -3 Query: 249 FIKSGVLPRVVDIYNDILNRGLEPDGYSYAGLLSALCNAGKFDYAVKLYQGIVRNSLCFD 70 ++K+G R +++Y +++ G +PD Y++AGLLSALC + D AVK+++ + + D Sbjct: 359 YVKAGYSSRALELYERMISEGFKPDKYTFAGLLSALCAENRNDEAVKVWRAVTMDH-TDD 417 Query: 69 AHITTVMADELIKVGKCQAA 10 HI TV+++EL K G+ + A Sbjct: 418 VHIHTVISNELKKAGQYEQA 437