BLASTX nr result
ID: Cimicifuga21_contig00031358
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00031358 (266 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003609218.1| Pentatricopeptide repeat-containing protein ... 92 6e-17 ref|XP_002280538.2| PREDICTED: pentatricopeptide repeat-containi... 92 6e-17 ref|XP_002325018.1| predicted protein [Populus trichocarpa] gi|2... 91 1e-16 ref|XP_003632713.1| PREDICTED: pentatricopeptide repeat-containi... 91 1e-16 emb|CBI29931.3| unnamed protein product [Vitis vinifera] 91 1e-16 >ref|XP_003609218.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355510273|gb|AES91415.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 1134 Score = 91.7 bits (226), Expect = 6e-17 Identities = 37/54 (68%), Positives = 45/54 (83%) Frame = -2 Query: 265 SVMPIRILKNIRVCGDCHMFMKFVSKIIGRPIVLRDSSLFHHFEGGYCSCKDYW 104 S +PIRI+KN+RVCGDCH K++SKI+GR I+LRDS+ FHHF GG CSC DYW Sbjct: 1081 SELPIRIMKNLRVCGDCHTAFKYISKIVGRQIILRDSNRFHHFGGGMCSCGDYW 1134 >ref|XP_002280538.2| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Vitis vinifera] gi|297738773|emb|CBI28018.3| unnamed protein product [Vitis vinifera] Length = 695 Score = 91.7 bits (226), Expect = 6e-17 Identities = 40/51 (78%), Positives = 44/51 (86%) Frame = -2 Query: 256 PIRILKNIRVCGDCHMFMKFVSKIIGRPIVLRDSSLFHHFEGGYCSCKDYW 104 PIRI+KNIRVCGDCH+FMKFVSKII RPI+LRD + FHHF G CSCKD W Sbjct: 645 PIRIMKNIRVCGDCHVFMKFVSKIIRRPIILRDINRFHHFIEGRCSCKDSW 695 >ref|XP_002325018.1| predicted protein [Populus trichocarpa] gi|222866452|gb|EEF03583.1| predicted protein [Populus trichocarpa] Length = 695 Score = 90.9 bits (224), Expect = 1e-16 Identities = 38/53 (71%), Positives = 43/53 (81%) Frame = -2 Query: 262 VMPIRILKNIRVCGDCHMFMKFVSKIIGRPIVLRDSSLFHHFEGGYCSCKDYW 104 V PIRI+KNIR C DCH+FMKFVS I RP++LRDS+ FHHF G CSCKDYW Sbjct: 643 VTPIRIIKNIRTCADCHIFMKFVSNITRRPVILRDSNRFHHFVEGKCSCKDYW 695 >ref|XP_003632713.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like [Vitis vinifera] Length = 989 Score = 90.5 bits (223), Expect = 1e-16 Identities = 37/54 (68%), Positives = 45/54 (83%) Frame = -2 Query: 265 SVMPIRILKNIRVCGDCHMFMKFVSKIIGRPIVLRDSSLFHHFEGGYCSCKDYW 104 + MPIR++KN+RVC DCH ++KFVSKI R IV+RD+ FHHFEGG CSCKDYW Sbjct: 936 NTMPIRVIKNLRVCNDCHNWIKFVSKISNRAIVVRDAYRFHHFEGGVCSCKDYW 989 >emb|CBI29931.3| unnamed protein product [Vitis vinifera] Length = 838 Score = 90.5 bits (223), Expect = 1e-16 Identities = 37/54 (68%), Positives = 45/54 (83%) Frame = -2 Query: 265 SVMPIRILKNIRVCGDCHMFMKFVSKIIGRPIVLRDSSLFHHFEGGYCSCKDYW 104 + MPIR++KN+RVC DCH ++KFVSKI R IV+RD+ FHHFEGG CSCKDYW Sbjct: 785 NTMPIRVIKNLRVCNDCHNWIKFVSKISNRAIVVRDAYRFHHFEGGVCSCKDYW 838