BLASTX nr result
ID: Cimicifuga21_contig00031308
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00031308 (233 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003544130.1| PREDICTED: uncharacterized protein LOC100802... 57 2e-06 gb|EKG08895.1| Chromo domain-like protein [Macrophomina phaseoli... 55 8e-06 >ref|XP_003544130.1| PREDICTED: uncharacterized protein LOC100802101 [Glycine max] Length = 420 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/41 (58%), Positives = 30/41 (73%) Frame = -2 Query: 223 RETKELRNRSVSLVKIQWTTDERDVTWELEETMRRKHPRLF 101 R TK LR + ++LVK+QW TDE D TWELE+ MR +P LF Sbjct: 378 RRTKSLRGKEIALVKVQWGTDEGDSTWELEDRMRELYPSLF 418 >gb|EKG08895.1| Chromo domain-like protein [Macrophomina phaseolina MS6] Length = 162 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/43 (53%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = -2 Query: 223 RETKELRNRSVSLVKIQWTT-DERDVTWELEETMRRKHPRLFD 98 RE K+LR+R + VK+QW+ D R+ TWELEE+MR+++P LF+ Sbjct: 117 REVKKLRSRKIPYVKVQWSNHDVREATWELEESMRKEYPHLFE 159