BLASTX nr result
ID: Cimicifuga21_contig00031034
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00031034 (430 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003598202.1| 60S ribosomal protein L23 [Medicago truncatu... 60 1e-07 ref|XP_003612608.1| Replication protein A 70 kDa DNA-binding sub... 60 2e-07 ref|NP_187562.1| RNase H domain-containing protein [Arabidopsis ... 59 4e-07 gb|AAD24831.1| putative non-LTR retroelement reverse transcripta... 59 4e-07 ref|XP_003613174.1| hypothetical protein MTR_5g033620 [Medicago ... 58 9e-07 >ref|XP_003598202.1| 60S ribosomal protein L23 [Medicago truncatula] gi|355487250|gb|AES68453.1| 60S ribosomal protein L23 [Medicago truncatula] Length = 547 Score = 60.5 bits (145), Expect = 1e-07 Identities = 36/88 (40%), Positives = 48/88 (54%) Frame = -3 Query: 383 EEGEARGLLIAIQWAYSLGYSTVIFELDCKAVVDFLHGEKPNIGATTKNILEDARLFADM 204 +E EA GL AI W L S V ELDCK VVD ++ +K N A +I++D R Sbjct: 108 QEAEAVGLRDAILWLGQLELSNVQLELDCKLVVDSIY-DKNNNQAEFGSIIDDCRSLLQQ 166 Query: 203 FYFISILYVRRSGNVVTHTLAKKAVSWP 120 F I +VRR NVV H+ A+ ++ P Sbjct: 167 FTNFKISFVRRQANVVAHSFARVSIFQP 194 >ref|XP_003612608.1| Replication protein A 70 kDa DNA-binding subunit [Medicago truncatula] gi|355513943|gb|AES95566.1| Replication protein A 70 kDa DNA-binding subunit [Medicago truncatula] Length = 1723 Score = 60.1 bits (144), Expect = 2e-07 Identities = 34/108 (31%), Positives = 54/108 (50%) Frame = -3 Query: 380 EGEARGLLIAIQWAYSLGYSTVIFELDCKAVVDFLHGEKPNIGATTKNILEDARLFADMF 201 EGEA GLL AI+WA + + FELD K VV H + ++ I E F+ F Sbjct: 1616 EGEAIGLLYAIRWAKEQNLNNITFELDSKRVVYSFHNTRNDVSDLGAIIRECRTTFSSFF 1675 Query: 200 YFISILYVRRSGNVVTHTLAKKAVSWPFLIWENIAPPWLDEQLLLDNR 57 + ++RR N V H+LA+ A + + + + P + + L+ + R Sbjct: 1676 TNSRVEFIRRQANEVVHSLARAATFYASIHYFTVLPDCIQDVLINEMR 1723 >ref|NP_187562.1| RNase H domain-containing protein [Arabidopsis thaliana] gi|6682231|gb|AAF23283.1|AC016661_8 putative non-LTR reverse transcriptase [Arabidopsis thaliana] gi|332641254|gb|AEE74775.1| RNase H domain-containing protein [Arabidopsis thaliana] Length = 484 Score = 58.9 bits (141), Expect = 4e-07 Identities = 36/114 (31%), Positives = 58/114 (50%), Gaps = 3/114 (2%) Frame = -3 Query: 392 HTAE--EGEARGLLIAIQWAYSLGYSTVIFELDCKAVVDFLHGEKPNIGATTKNILEDAR 219 HT+ E E + LL A+Q + GY+ V E DC+ +++ ++G + ++ N LED Sbjct: 372 HTSNPLEAETKALLAALQQTWIRGYTQVFMEGDCQTLINLING--ISFHSSLANHLEDIS 429 Query: 218 LFADMFYFISILYVRRSGNVVTHTLAKKAVSW-PFLIWENIAPPWLDEQLLLDN 60 +A+ F I ++RR GN + H LAK ++ F P WLD D+ Sbjct: 430 FWANKFASIQFGFIRRKGNKLAHVLAKYGCTYSTFYSGSGSLPIWLDRYFCNDS 483 >gb|AAD24831.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis thaliana] Length = 1524 Score = 58.9 bits (141), Expect = 4e-07 Identities = 36/114 (31%), Positives = 58/114 (50%), Gaps = 3/114 (2%) Frame = -3 Query: 392 HTAE--EGEARGLLIAIQWAYSLGYSTVIFELDCKAVVDFLHGEKPNIGATTKNILEDAR 219 HT+ E E + LL A+Q + GY+ V E DC+ +++ ++G + ++ N LED Sbjct: 1412 HTSNPLEAETKALLAALQQTWIRGYTQVFMEGDCQTLINLING--ISFHSSLANHLEDIS 1469 Query: 218 LFADMFYFISILYVRRSGNVVTHTLAKKAVSW-PFLIWENIAPPWLDEQLLLDN 60 +A+ F I ++RR GN + H LAK ++ F P WLD D+ Sbjct: 1470 FWANKFASIQFGFIRRKGNKLAHVLAKYGCTYSTFYSGSGSLPIWLDRYFCNDS 1523 >ref|XP_003613174.1| hypothetical protein MTR_5g033620 [Medicago truncatula] gi|355514509|gb|AES96132.1| hypothetical protein MTR_5g033620 [Medicago truncatula] Length = 119 Score = 57.8 bits (138), Expect = 9e-07 Identities = 34/86 (39%), Positives = 52/86 (60%), Gaps = 1/86 (1%) Frame = -3 Query: 383 EEGEARGLLIAIQWAYSLGYSTVIFELDCKAVVDFLHGEKPNIGATTKNILEDARLFADM 204 E GEA GLL AIQW + L + V FE+D K VVD+ + N+ + ILE+ + ++ Sbjct: 11 EIGEALGLLYAIQWVHELQLTNVDFEMDAKLVVDYFNKGSNNV-SEFGAILEECKRCRNV 69 Query: 203 FYFIS-ILYVRRSGNVVTHTLAKKAV 129 ++ S + + RR N V HTLA++A+ Sbjct: 70 YFENSKVKFSRRQANEVAHTLAREAL 95