BLASTX nr result
ID: Cimicifuga21_contig00030929
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00030929 (240 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002489092.1| hypothetical protein SORBIDRAFT_0088s002240 ... 70 2e-10 ref|XP_002535070.1| conserved hypothetical protein [Ricinus comm... 67 1e-09 ref|XP_002536345.1| conserved hypothetical protein [Ricinus comm... 67 1e-09 ref|XP_003588351.1| Maturase [Medicago truncatula] gi|355477399|... 63 3e-08 >ref|XP_002489092.1| hypothetical protein SORBIDRAFT_0088s002240 [Sorghum bicolor] gi|241947412|gb|EES20557.1| hypothetical protein SORBIDRAFT_0088s002240 [Sorghum bicolor] Length = 58 Score = 69.7 bits (169), Expect = 2e-10 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = +1 Query: 10 LSTALLTEPYVDVTAHTAPSQQAVSLPLQGMEVWMNRHQ 126 +S LLTEPYVDVTAHTAPSQQAVS PL+ MEVW+NRHQ Sbjct: 6 ISVHLLTEPYVDVTAHTAPSQQAVSFPLEVMEVWINRHQ 44 >ref|XP_002535070.1| conserved hypothetical protein [Ricinus communis] gi|223524097|gb|EEF27311.1| conserved hypothetical protein [Ricinus communis] Length = 93 Score = 67.4 bits (163), Expect = 1e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 90 RKANCLLAGSCMSGNVHVRLREKGGGQKWP 1 RKANCLLAGSCMSGNVHVR REKGGGQKWP Sbjct: 63 RKANCLLAGSCMSGNVHVRFREKGGGQKWP 92 >ref|XP_002536345.1| conserved hypothetical protein [Ricinus communis] gi|223520024|gb|EEF26037.1| conserved hypothetical protein [Ricinus communis] Length = 99 Score = 67.4 bits (163), Expect = 1e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 90 RKANCLLAGSCMSGNVHVRLREKGGGQKWP 1 RKANCLLAGSCMSGNVHVR REKGGGQKWP Sbjct: 1 RKANCLLAGSCMSGNVHVRFREKGGGQKWP 30 >ref|XP_003588351.1| Maturase [Medicago truncatula] gi|355477399|gb|AES58602.1| Maturase [Medicago truncatula] Length = 996 Score = 62.8 bits (151), Expect = 3e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 90 RKANCLLAGSCMSGNVHVRLREKGGGQKWP 1 R+A+CL AGSCMSGNVHVRLREKGGGQKWP Sbjct: 24 READCLPAGSCMSGNVHVRLREKGGGQKWP 53