BLASTX nr result
ID: Cimicifuga21_contig00030886
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00030886 (209 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002284795.1| PREDICTED: F-box protein SKIP23-like [Vitis ... 60 2e-07 emb|CAN69116.1| hypothetical protein VITISV_031843 [Vitis vinifera] 60 2e-07 ref|XP_002438790.1| hypothetical protein SORBIDRAFT_10g026280 [S... 57 1e-06 >ref|XP_002284795.1| PREDICTED: F-box protein SKIP23-like [Vitis vinifera] Length = 389 Score = 59.7 bits (143), Expect = 2e-07 Identities = 32/62 (51%), Positives = 38/62 (61%) Frame = +3 Query: 6 LDGHAVFLGKNTSLSVLASDYPGYKPNCIYYTDNMPMFRYFCPVTPGHLGIFNFEDGSTE 185 L A+FLG+N SLS+ + D+PG K NCIYYTD+ Y LGIFN EDGS E Sbjct: 308 LGDRALFLGENLSLSLSSVDFPGCKGNCIYYTDDYSEDNYDGIGGEQDLGIFNLEDGSIE 367 Query: 186 QL 191 L Sbjct: 368 PL 369 >emb|CAN69116.1| hypothetical protein VITISV_031843 [Vitis vinifera] Length = 389 Score = 59.7 bits (143), Expect = 2e-07 Identities = 32/62 (51%), Positives = 38/62 (61%) Frame = +3 Query: 6 LDGHAVFLGKNTSLSVLASDYPGYKPNCIYYTDNMPMFRYFCPVTPGHLGIFNFEDGSTE 185 L A+FLG+N SLS+ + D+PG K NCIYYTD+ Y LGIFN EDGS E Sbjct: 308 LGDRALFLGENLSLSLSSVDFPGCKGNCIYYTDDYSEDNYDGIGGEQDLGIFNLEDGSIE 367 Query: 186 QL 191 L Sbjct: 368 PL 369 >ref|XP_002438790.1| hypothetical protein SORBIDRAFT_10g026280 [Sorghum bicolor] gi|241917013|gb|EER90157.1| hypothetical protein SORBIDRAFT_10g026280 [Sorghum bicolor] Length = 460 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/64 (40%), Positives = 38/64 (59%) Frame = +3 Query: 6 LDGHAVFLGKNTSLSVLASDYPGYKPNCIYYTDNMPMFRYFCPVTPGHLGIFNFEDGSTE 185 L HA+F+G N S ++ A+D G P+ +YYTDN + + P P +GI+N DGS Sbjct: 376 LGDHALFVGCNYSFALAATDSAGVLPSHVYYTDNEEQYALYSPECPRDIGIYNVGDGSFH 435 Query: 186 QLYP 197 Q+ P Sbjct: 436 QIQP 439