BLASTX nr result
ID: Cimicifuga21_contig00028640
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00028640 (344 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002303396.1| predicted protein [Populus trichocarpa] gi|2... 101 7e-20 ref|XP_002975258.1| hypothetical protein SELMODRAFT_451567 [Sela... 96 3e-18 ref|XP_002987435.1| hypothetical protein SELMODRAFT_451566 [Sela... 96 3e-18 ref|XP_002520397.1| conserved hypothetical protein [Ricinus comm... 95 7e-18 gb|ELR22110.1| Rrm3p helicase [Acanthamoeba castellanii str. Neff] 79 3e-13 >ref|XP_002303396.1| predicted protein [Populus trichocarpa] gi|222840828|gb|EEE78375.1| predicted protein [Populus trichocarpa] Length = 493 Score = 101 bits (251), Expect = 7e-20 Identities = 50/70 (71%), Positives = 58/70 (82%) Frame = +3 Query: 3 AVSIHKCQGMTLDCLHTDLARAFGYGMVYVALSRARSLKGIYLSGFDSLKIKAHPKVLEF 182 A+SIHKCQGMTLD TDL+RAFGYGMVYVALSR RSL+G++LSGF KIKAHPKVL F Sbjct: 412 AISIHKCQGMTLDHAQTDLSRAFGYGMVYVALSRVRSLEGLHLSGFTPSKIKAHPKVLLF 471 Query: 183 YENHLVS*IS 212 Y++ S +S Sbjct: 472 YKSFTSSNLS 481 >ref|XP_002975258.1| hypothetical protein SELMODRAFT_451567 [Selaginella moellendorffii] gi|300156832|gb|EFJ23459.1| hypothetical protein SELMODRAFT_451567 [Selaginella moellendorffii] Length = 580 Score = 95.9 bits (237), Expect = 3e-18 Identities = 43/62 (69%), Positives = 52/62 (83%) Frame = +3 Query: 3 AVSIHKCQGMTLDCLHTDLARAFGYGMVYVALSRARSLKGIYLSGFDSLKIKAHPKVLEF 182 A+S+HKCQGMTLDC+ TDL+R F YGMVYVALSR RSL G+ L GFD LKI+ HP+V+ F Sbjct: 514 ALSVHKCQGMTLDCVETDLSRTFEYGMVYVALSRVRSLHGLRLLGFDPLKIRVHPEVVTF 573 Query: 183 YE 188 Y+ Sbjct: 574 YD 575 >ref|XP_002987435.1| hypothetical protein SELMODRAFT_451566 [Selaginella moellendorffii] gi|300144841|gb|EFJ11522.1| hypothetical protein SELMODRAFT_451566 [Selaginella moellendorffii] Length = 580 Score = 95.9 bits (237), Expect = 3e-18 Identities = 43/62 (69%), Positives = 52/62 (83%) Frame = +3 Query: 3 AVSIHKCQGMTLDCLHTDLARAFGYGMVYVALSRARSLKGIYLSGFDSLKIKAHPKVLEF 182 A+S+HKCQGMTLDC+ TDL+R F YGMVYVALSR RSL G+ L GFD LKI+ HP+V+ F Sbjct: 514 ALSVHKCQGMTLDCVETDLSRTFEYGMVYVALSRVRSLHGLRLLGFDPLKIRVHPEVVTF 573 Query: 183 YE 188 Y+ Sbjct: 574 YD 575 >ref|XP_002520397.1| conserved hypothetical protein [Ricinus communis] gi|223540444|gb|EEF42013.1| conserved hypothetical protein [Ricinus communis] Length = 512 Score = 94.7 bits (234), Expect = 7e-18 Identities = 43/62 (69%), Positives = 53/62 (85%) Frame = +3 Query: 3 AVSIHKCQGMTLDCLHTDLARAFGYGMVYVALSRARSLKGIYLSGFDSLKIKAHPKVLEF 182 A+SIHKCQGMT+DCL+TDL+R+F YGMVY LSR R++KGI LSGF+ IKA+PKVL F Sbjct: 396 ALSIHKCQGMTIDCLYTDLSRSFIYGMVYAVLSRGRTMKGIQLSGFEPSMIKANPKVLHF 455 Query: 183 YE 188 Y+ Sbjct: 456 YD 457 >gb|ELR22110.1| Rrm3p helicase [Acanthamoeba castellanii str. Neff] Length = 805 Score = 79.3 bits (194), Expect = 3e-13 Identities = 35/61 (57%), Positives = 49/61 (80%) Frame = +3 Query: 3 AVSIHKCQGMTLDCLHTDLARAFGYGMVYVALSRARSLKGIYLSGFDSLKIKAHPKVLEF 182 A+SIHK QGMTL + +L+ F YG YVALSRA++L+G+YL GF++ K++AHP+VLE+ Sbjct: 673 ALSIHKSQGMTLSKVEMNLSHVFAYGQAYVALSRAQNLEGLYLMGFEAGKVRAHPRVLEY 732 Query: 183 Y 185 Y Sbjct: 733 Y 733