BLASTX nr result
ID: Cimicifuga21_contig00027939
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00027939 (327 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513096.1| conserved hypothetical protein [Ricinus comm... 97 7e-23 ref|XP_003588305.1| hypothetical protein MTR_1g005670 [Medicago ... 106 2e-21 ref|XP_002535310.1| conserved hypothetical protein [Ricinus comm... 100 2e-19 gb|ABE98701.1| hypothetical protein (mitochondrion) [Zea mays su... 84 2e-14 gb|ABE98744.1| hypothetical protein (mitochondrion) [Zea mays su... 84 2e-14 >ref|XP_002513096.1| conserved hypothetical protein [Ricinus communis] gi|223548107|gb|EEF49599.1| conserved hypothetical protein [Ricinus communis] Length = 813 Score = 97.4 bits (241), Expect(2) = 7e-23 Identities = 44/46 (95%), Positives = 44/46 (95%) Frame = -1 Query: 219 HRGVVARVSRPGILHLAFMISTFNCAPETRSKHARPVCFFHDMLWS 82 H GVVARVSRPGILHLAFMISTF CAPETRSKHARPVCFFHDMLWS Sbjct: 753 HMGVVARVSRPGILHLAFMISTFRCAPETRSKHARPVCFFHDMLWS 798 Score = 34.7 bits (78), Expect(2) = 7e-23 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -2 Query: 254 GRRGPGCASDRHIG 213 GRRGPGCASDRH+G Sbjct: 742 GRRGPGCASDRHMG 755 >ref|XP_003588305.1| hypothetical protein MTR_1g005670 [Medicago truncatula] gi|355477353|gb|AES58556.1| hypothetical protein MTR_1g005670 [Medicago truncatula] Length = 250 Score = 106 bits (264), Expect = 2e-21 Identities = 50/52 (96%), Positives = 50/52 (96%) Frame = -1 Query: 165 MISTFNCAPETRSKHARPVCFFHDMLWSRVSSCGLLALEEVVSVPDICNVLP 10 MISTFNCAPETRSKHARPVCFFHDMLWSRVSS GLLALEEVVSVPDIC VLP Sbjct: 1 MISTFNCAPETRSKHARPVCFFHDMLWSRVSSSGLLALEEVVSVPDICYVLP 52 >ref|XP_002535310.1| conserved hypothetical protein [Ricinus communis] gi|255590896|ref|XP_002535392.1| conserved hypothetical protein [Ricinus communis] gi|223523262|gb|EEF26991.1| conserved hypothetical protein [Ricinus communis] gi|223523475|gb|EEF27071.1| conserved hypothetical protein [Ricinus communis] Length = 94 Score = 100 bits (248), Expect = 2e-19 Identities = 46/49 (93%), Positives = 46/49 (93%) Frame = +3 Query: 3 KGVGGRCRCPGRTRLLLTLEDHRKTPGTRACRERSTLGGRASTVSPGHS 149 K VGGRCRCPGRTRLLLTLEDHR PGTRACRERSTLGGRASTVSPGHS Sbjct: 46 KSVGGRCRCPGRTRLLLTLEDHRNIPGTRACRERSTLGGRASTVSPGHS 94 >gb|ABE98701.1| hypothetical protein (mitochondrion) [Zea mays subsp. mays] gi|102579661|gb|ABF70941.1| hypothetical protein (mitochondrion) [Zea mays subsp. mays] Length = 163 Score = 83.6 bits (205), Expect = 2e-14 Identities = 39/46 (84%), Positives = 39/46 (84%) Frame = +3 Query: 3 KGVGGRCRCPGRTRLLLTLEDHRKTPGTRACRERSTLGGRASTVSP 140 KGV GRCRCPGRTRLLLTLEDHRK PGTRACRER T GGRAS P Sbjct: 47 KGVRGRCRCPGRTRLLLTLEDHRKKPGTRACRERRTRGGRASDQCP 92 >gb|ABE98744.1| hypothetical protein (mitochondrion) [Zea mays subsp. mays] gi|93116158|gb|ABE98789.1| hypothetical protein [Zea mays subsp. mays] gi|413954480|gb|AFW87129.1| putative uncharacterized protein orf127 [Zea mays] Length = 159 Score = 83.6 bits (205), Expect = 2e-14 Identities = 39/46 (84%), Positives = 39/46 (84%) Frame = +3 Query: 3 KGVGGRCRCPGRTRLLLTLEDHRKTPGTRACRERSTLGGRASTVSP 140 KGV GRCRCPGRTRLLLTLEDHRK PGTRACRER T GGRAS P Sbjct: 47 KGVRGRCRCPGRTRLLLTLEDHRKKPGTRACRERRTRGGRASDQCP 92