BLASTX nr result
ID: Cimicifuga21_contig00027923
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00027923 (492 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI21902.3| unnamed protein product [Vitis vinifera] 94 1e-17 ref|XP_002275272.1| PREDICTED: uncharacterized protein LOC100250... 94 1e-17 emb|CAN73827.1| hypothetical protein VITISV_003176 [Vitis vinifera] 94 1e-17 ref|XP_002865379.1| hypothetical protein ARALYDRAFT_494576 [Arab... 94 2e-17 ref|XP_002517852.1| homeobox protein, putative [Ricinus communis... 94 2e-17 >emb|CBI21902.3| unnamed protein product [Vitis vinifera] Length = 1870 Score = 94.0 bits (232), Expect = 1e-17 Identities = 43/52 (82%), Positives = 48/52 (92%) Frame = -2 Query: 197 MKSAAQLEVLENTYLLETYPSEALRAELSVKLGLTDRQLQMWFCHRRLKDRK 42 MK+A+QLE+LE TY +ETYPSE LRAELS KLGL+DRQLQMWFCHRRLKDRK Sbjct: 23 MKTASQLEILEKTYAVETYPSETLRAELSAKLGLSDRQLQMWFCHRRLKDRK 74 >ref|XP_002275272.1| PREDICTED: uncharacterized protein LOC100250601 [Vitis vinifera] Length = 1772 Score = 94.0 bits (232), Expect = 1e-17 Identities = 43/52 (82%), Positives = 48/52 (92%) Frame = -2 Query: 197 MKSAAQLEVLENTYLLETYPSEALRAELSVKLGLTDRQLQMWFCHRRLKDRK 42 MK+A+QLE+LE TY +ETYPSE LRAELS KLGL+DRQLQMWFCHRRLKDRK Sbjct: 23 MKTASQLEILEKTYAVETYPSETLRAELSAKLGLSDRQLQMWFCHRRLKDRK 74 >emb|CAN73827.1| hypothetical protein VITISV_003176 [Vitis vinifera] Length = 533 Score = 94.0 bits (232), Expect = 1e-17 Identities = 43/52 (82%), Positives = 48/52 (92%) Frame = -2 Query: 197 MKSAAQLEVLENTYLLETYPSEALRAELSVKLGLTDRQLQMWFCHRRLKDRK 42 MK+A+QLE+LE TY +ETYPSE LRAELS KLGL+DRQLQMWFCHRRLKDRK Sbjct: 225 MKTASQLEILEKTYAVETYPSETLRAELSAKLGLSDRQLQMWFCHRRLKDRK 276 >ref|XP_002865379.1| hypothetical protein ARALYDRAFT_494576 [Arabidopsis lyrata subsp. lyrata] gi|297311214|gb|EFH41638.1| hypothetical protein ARALYDRAFT_494576 [Arabidopsis lyrata subsp. lyrata] Length = 1684 Score = 93.6 bits (231), Expect = 2e-17 Identities = 44/52 (84%), Positives = 48/52 (92%) Frame = -2 Query: 197 MKSAAQLEVLENTYLLETYPSEALRAELSVKLGLTDRQLQMWFCHRRLKDRK 42 MK+AAQLEVLENTY E YPSEA+RA+LSVKL L+DRQLQMWFCHRRLKDRK Sbjct: 21 MKTAAQLEVLENTYAAEPYPSEAIRADLSVKLNLSDRQLQMWFCHRRLKDRK 72 >ref|XP_002517852.1| homeobox protein, putative [Ricinus communis] gi|223542834|gb|EEF44370.1| homeobox protein, putative [Ricinus communis] Length = 1784 Score = 93.6 bits (231), Expect = 2e-17 Identities = 43/52 (82%), Positives = 48/52 (92%) Frame = -2 Query: 197 MKSAAQLEVLENTYLLETYPSEALRAELSVKLGLTDRQLQMWFCHRRLKDRK 42 MK+A+QLE+LE TY +ETYPSE LRAELS +LGLTDRQLQMWFCHRRLKDRK Sbjct: 29 MKTASQLEILEKTYAVETYPSEELRAELSAQLGLTDRQLQMWFCHRRLKDRK 80