BLASTX nr result
ID: Cimicifuga21_contig00026776
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00026776 (269 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA66153.1| hypothetical protein [Beta vulgaris subsp. vulga... 55 8e-06 >emb|CCA66153.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1381 Score = 54.7 bits (130), Expect = 8e-06 Identities = 20/57 (35%), Positives = 38/57 (66%) Frame = +2 Query: 71 CFFCSSALESVDHILLVCTFAWQV*SYFFEVSRLSWVCPGRVMLLFSHWQFDPFSSR 241 C FCSS++ES +H+ L C+++ ++ ++F++ ++WV P + LF+HW PF + Sbjct: 1090 CIFCSSSIESTNHLFLECSYSKELWHWWFQIWNVAWVLPSSIKELFTHW-IPPFKGK 1145