BLASTX nr result
ID: Cimicifuga21_contig00026658
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00026658 (354 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281941.1| PREDICTED: protein brittle-1, chloroplastic/... 57 2e-06 >ref|XP_002281941.1| PREDICTED: protein brittle-1, chloroplastic/amyloplastic [Vitis vinifera] gi|147768735|emb|CAN60465.1| hypothetical protein VITISV_012495 [Vitis vinifera] Length = 400 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/53 (52%), Positives = 34/53 (64%) Frame = -2 Query: 200 MDRRRLQPVEAKKNDFSSCCEMGFQWIPQEDCFPTGGLFASIGKMGMVVGITP 42 M R LQ VE + S +GFQW PQE+CF GGLFAS+G+ GM GI+P Sbjct: 1 MGGRGLQGVERNGDVLFSTSGLGFQWSPQENCFHPGGLFASVGQAGMGFGISP 53