BLASTX nr result
ID: Cimicifuga21_contig00026468
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00026468 (204 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265371.1| PREDICTED: acyl-CoA synthetase family member... 99 4e-19 ref|XP_003627657.1| Acetyl-coenzyme A synthetase [Medicago trunc... 86 2e-15 ref|XP_004138998.1| PREDICTED: putative acyl-activating enzyme 1... 86 3e-15 ref|NP_198442.2| AMP-dependent synthetase and ligase family prot... 85 7e-15 gb|AAM20623.1| unknown protein [Arabidopsis thaliana] 85 7e-15 >ref|XP_002265371.1| PREDICTED: acyl-CoA synthetase family member 4 [Vitis vinifera] gi|296088768|emb|CBI38218.3| unnamed protein product [Vitis vinifera] Length = 1175 Score = 99.0 bits (245), Expect = 4e-19 Identities = 48/60 (80%), Positives = 53/60 (88%) Frame = -2 Query: 200 ILGIYMVPSVEYIVAVLSVLRCREAFLPLDPSWPKQRILSIISSSKVALIVRCNSSFYAS 21 ILGIYMVPSVEYI+AVLSVLRC EAF+PLDPSWPK+RILSI+SSS V LI+ C SSF S Sbjct: 138 ILGIYMVPSVEYIIAVLSVLRCGEAFMPLDPSWPKERILSIVSSSNVDLIIGCRSSFDTS 197 >ref|XP_003627657.1| Acetyl-coenzyme A synthetase [Medicago truncatula] gi|355521679|gb|AET02133.1| Acetyl-coenzyme A synthetase [Medicago truncatula] Length = 1224 Score = 86.3 bits (212), Expect = 2e-15 Identities = 43/60 (71%), Positives = 48/60 (80%) Frame = -2 Query: 200 ILGIYMVPSVEYIVAVLSVLRCREAFLPLDPSWPKQRILSIISSSKVALIVRCNSSFYAS 21 I+GIYM PSVEYI+AVLSVLRC EAFLPLDP WP +RILS+ SSS V LI+ SSF S Sbjct: 145 IVGIYMPPSVEYIIAVLSVLRCGEAFLPLDPFWPNERILSVASSSNVDLIIGSQSSFSKS 204 >ref|XP_004138998.1| PREDICTED: putative acyl-activating enzyme 19-like [Cucumis sativus] Length = 1209 Score = 85.9 bits (211), Expect = 3e-15 Identities = 41/66 (62%), Positives = 50/66 (75%) Frame = -2 Query: 200 ILGIYMVPSVEYIVAVLSVLRCREAFLPLDPSWPKQRILSIISSSKVALIVRCNSSFYAS 21 I GIYM PSVEYI++VLSVLRC AF+PLDP+WPK+RILS++SS K+ LI+ SSF Sbjct: 132 IFGIYMPPSVEYIISVLSVLRCGGAFMPLDPAWPKRRILSVVSSLKIDLIIYSGSSFCVD 191 Query: 20 ESHQPE 3 H E Sbjct: 192 GYHVTE 197 >ref|NP_198442.2| AMP-dependent synthetase and ligase family protein [Arabidopsis thaliana] gi|378548266|sp|F4K1G2.1|AEE19_ARATH RecName: Full=Putative acyl-activating enzyme 19 gi|332006646|gb|AED94029.1| AMP-dependent synthetase and ligase family protein [Arabidopsis thaliana] Length = 1040 Score = 84.7 bits (208), Expect = 7e-15 Identities = 37/63 (58%), Positives = 52/63 (82%) Frame = -2 Query: 200 ILGIYMVPSVEYIVAVLSVLRCREAFLPLDPSWPKQRILSIISSSKVALIVRCNSSFYAS 21 ++ +YM PSVEY+++V SVLRC EAFLPLDPSWP++R+LS+ISSS ++L++ C S + Sbjct: 4 VVALYMPPSVEYVISVFSVLRCGEAFLPLDPSWPRERVLSLISSSNISLVIACGLS--SV 61 Query: 20 ESH 12 ESH Sbjct: 62 ESH 64 >gb|AAM20623.1| unknown protein [Arabidopsis thaliana] Length = 1040 Score = 84.7 bits (208), Expect = 7e-15 Identities = 37/63 (58%), Positives = 52/63 (82%) Frame = -2 Query: 200 ILGIYMVPSVEYIVAVLSVLRCREAFLPLDPSWPKQRILSIISSSKVALIVRCNSSFYAS 21 ++ +YM PSVEY+++V SVLRC EAFLPLDPSWP++R+LS+ISSS ++L++ C S + Sbjct: 4 VVALYMPPSVEYVISVFSVLRCGEAFLPLDPSWPRERVLSLISSSNISLVIACGLS--SV 61 Query: 20 ESH 12 ESH Sbjct: 62 ESH 64