BLASTX nr result
ID: Cimicifuga21_contig00026327
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00026327 (280 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526779.1| leucine-rich repeat containing protein, puta... 61 2e-08 ref|XP_002274507.2| PREDICTED: putative disease resistance prote... 61 8e-08 emb|CAN82719.1| hypothetical protein VITISV_004244 [Vitis vinifera] 61 8e-08 ref|XP_002275064.2| PREDICTED: putative disease resistance prote... 60 1e-07 emb|CBI40025.3| unnamed protein product [Vitis vinifera] 60 1e-07 >ref|XP_002526779.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223533855|gb|EEF35585.1| leucine-rich repeat containing protein, putative [Ricinus communis] Length = 1174 Score = 61.2 bits (147), Expect(2) = 2e-08 Identities = 28/48 (58%), Positives = 38/48 (79%) Frame = +1 Query: 28 LRFLKSLQDLEISFCPKLQSLPKEGMLHSLQSLIISSCPLLSERCRKK 171 L+ L SL++LEI CPKLQS+PKEG+ SL SL +S CPLL +RC+++ Sbjct: 1106 LQHLTSLKELEICNCPKLQSMPKEGLPSSLSSLSVSLCPLLEQRCQRE 1153 Score = 21.9 bits (45), Expect(2) = 2e-08 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = +3 Query: 153 RKMQKERNTDWQKIKATPQFQI 218 ++ Q+ER DW +I P + Sbjct: 1148 QRCQRERGEDWIRISHIPHLNV 1169 >ref|XP_002274507.2| PREDICTED: putative disease resistance protein RGA3-like [Vitis vinifera] Length = 1263 Score = 61.2 bits (147), Expect = 8e-08 Identities = 32/61 (52%), Positives = 41/61 (67%), Gaps = 3/61 (4%) Frame = +1 Query: 1 CSNLVAL---PTLRFLKSLQDLEISFCPKLQSLPKEGMLHSLQSLIISSCPLLSERCRKK 171 C +L +L L+ L SL DL I CPKL+SLP+EG+ SLQ L+I CPLL ERCR + Sbjct: 1041 CPSLESLGPKDVLKSLSSLTDLYIEDCPKLKSLPEEGISPSLQHLVIQGCPLLMERCRNE 1100 Query: 172 E 174 + Sbjct: 1101 K 1101 >emb|CAN82719.1| hypothetical protein VITISV_004244 [Vitis vinifera] Length = 1521 Score = 61.2 bits (147), Expect = 8e-08 Identities = 32/61 (52%), Positives = 41/61 (67%), Gaps = 3/61 (4%) Frame = +1 Query: 1 CSNLVAL---PTLRFLKSLQDLEISFCPKLQSLPKEGMLHSLQSLIISSCPLLSERCRKK 171 C +L +L L+ L SL DL I CPKL+SLP+EG+ SLQ L+I CPLL ERCR + Sbjct: 1020 CPSLESLGPKDVLKSLSSLTDLYIEDCPKLKSLPEEGISPSLQHLVIQGCPLLMERCRNE 1079 Query: 172 E 174 + Sbjct: 1080 K 1080 >ref|XP_002275064.2| PREDICTED: putative disease resistance protein RGA3-like [Vitis vinifera] Length = 1018 Score = 60.5 bits (145), Expect = 1e-07 Identities = 32/61 (52%), Positives = 40/61 (65%), Gaps = 3/61 (4%) Frame = +1 Query: 1 CSNLVAL---PTLRFLKSLQDLEISFCPKLQSLPKEGMLHSLQSLIISSCPLLSERCRKK 171 C NL +L L+ L SL+DL I CPKL SLPKEG+ SLQ L+I CP+L ERC + Sbjct: 905 CHNLQSLGPDDVLKSLTSLKDLYIKDCPKLPSLPKEGVSISLQHLVIQGCPILVERCTED 964 Query: 172 E 174 + Sbjct: 965 D 965 >emb|CBI40025.3| unnamed protein product [Vitis vinifera] Length = 785 Score = 60.5 bits (145), Expect = 1e-07 Identities = 32/61 (52%), Positives = 40/61 (65%), Gaps = 3/61 (4%) Frame = +1 Query: 1 CSNLVAL---PTLRFLKSLQDLEISFCPKLQSLPKEGMLHSLQSLIISSCPLLSERCRKK 171 C NL +L L+ L SL+DL I CPKL SLPKEG+ SLQ L+I CP+L ERC + Sbjct: 575 CHNLQSLGPDDVLKSLTSLKDLYIKDCPKLPSLPKEGVSISLQHLVIQGCPILVERCTED 634 Query: 172 E 174 + Sbjct: 635 D 635