BLASTX nr result
ID: Cimicifuga21_contig00026289
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00026289 (214 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_187635.1| putative F-box protein [Arabidopsis thaliana] g... 55 8e-06 >ref|NP_187635.1| putative F-box protein [Arabidopsis thaliana] gi|75266243|sp|Q9SS35.1|FB137_ARATH RecName: Full=Putative F-box protein At3g10240 gi|6056201|gb|AAF02818.1|AC009400_14 hypothetical protein [Arabidopsis thaliana] gi|332641355|gb|AEE74876.1| putative F-box protein [Arabidopsis thaliana] Length = 389 Score = 54.7 bits (130), Expect = 8e-06 Identities = 30/73 (41%), Positives = 45/73 (61%), Gaps = 3/73 (4%) Frame = -1 Query: 214 NGLLCFVDYDRDYTMAVYNPATQQKLLLPKPSRTINDRPELFGLGFDPLSKKYKVL---Y 44 NGL+CF + R + V+NP+T+Q L+LPKP+ ND LG+DP+ K+KV+ + Sbjct: 130 NGLICFQESAR---LIVWNPSTRQLLILPKPNGNSNDL--TIFLGYDPVEGKHKVMCMEF 184 Query: 43 WSNYPHCEIFTLG 5 + Y C + TLG Sbjct: 185 SATYDTCRVLTLG 197