BLASTX nr result
ID: Cimicifuga21_contig00026180
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00026180 (352 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004138819.1| PREDICTED: uncharacterized protein LOC101219... 99 4e-19 ref|XP_002271842.1| PREDICTED: uncharacterized protein LOC100252... 99 5e-19 ref|XP_002321027.1| predicted protein [Populus trichocarpa] gi|2... 94 9e-18 ref|XP_002526725.1| conserved hypothetical protein [Ricinus comm... 93 3e-17 emb|CAN70295.1| hypothetical protein VITISV_035778 [Vitis vinifera] 91 1e-16 >ref|XP_004138819.1| PREDICTED: uncharacterized protein LOC101219073 [Cucumis sativus] Length = 382 Score = 99.0 bits (245), Expect = 4e-19 Identities = 50/102 (49%), Positives = 70/102 (68%) Frame = +3 Query: 6 FKKYPPFMGISVKRINSSLDFFMNSLNWTRADISRNPTVVLYSFEKRVIPRISVLQILLS 185 F K P FM S + + +LDFFMN +WTR +I R P V++ SFEKRV+PR S+LQ L+S Sbjct: 276 FLKQPCFMNRSEEGLKRALDFFMNKWDWTREEIYRYPIVLILSFEKRVMPRSSILQHLIS 335 Query: 186 KGLISKTGIGQAIREAEDIFLKKYVTKHHHELPDLLTVYQNK 311 KGLI + +G A++ +E FL+K+V ++ E P LL +YQ K Sbjct: 336 KGLIKRKSLGMALKISEHEFLEKFVMQYLSEDPHLLEMYQEK 377 >ref|XP_002271842.1| PREDICTED: uncharacterized protein LOC100252260 [Vitis vinifera] Length = 365 Score = 98.6 bits (244), Expect = 5e-19 Identities = 50/104 (48%), Positives = 70/104 (67%), Gaps = 1/104 (0%) Frame = +3 Query: 6 FKKYPPFMGISVKRINSSLDFFMNSLNWTRADISRNPTVVLYSFEKRVIPRISVLQILLS 185 F K P FM S RI LDF +N LNW DI + P V+L S EKRV+PR VLQ+L+ Sbjct: 258 FVKQPQFMSNSETRIRKCLDFLINELNWMPEDIFKYPMVLLLSLEKRVVPRSRVLQLLIG 317 Query: 186 KGLISKTGIGQAIREAEDIFLKKYVTKHHHELPDLLTVYQ-NKV 314 KGL+++ IG+A+ +ED F+K +++ + ++P+LL VYQ NKV Sbjct: 318 KGLVTRRSIGRALIISEDRFMKVFMSSYEKKIPELLEVYQSNKV 361 >ref|XP_002321027.1| predicted protein [Populus trichocarpa] gi|222861800|gb|EEE99342.1| predicted protein [Populus trichocarpa] Length = 400 Score = 94.4 bits (233), Expect = 9e-18 Identities = 47/109 (43%), Positives = 68/109 (62%), Gaps = 1/109 (0%) Frame = +3 Query: 3 AFKKYPPFMGISVKRINSSLDFFMNSLNWTRADISRNPTVVLYSFEKRVIPRISVLQILL 182 AF+K+P M +S K+I LDFF+N + W +I P ++ S EKR+IPR V+Q+L Sbjct: 291 AFRKHPHCMMLSEKKIMKGLDFFVNKMGWPSKEIVHCPVILFLSLEKRIIPRCKVIQVLW 350 Query: 183 SKGLISK-TGIGQAIREAEDIFLKKYVTKHHHELPDLLTVYQNKVCTQG 326 SKGLI K + + E FL+++VTK E+P LL+VY+ KV +G Sbjct: 351 SKGLIKKDISLNTVLLPVEKRFLERFVTKFEEEVPQLLSVYEGKVDPEG 399 >ref|XP_002526725.1| conserved hypothetical protein [Ricinus communis] gi|223533914|gb|EEF35639.1| conserved hypothetical protein [Ricinus communis] Length = 441 Score = 92.8 bits (229), Expect = 3e-17 Identities = 42/103 (40%), Positives = 69/103 (66%) Frame = +3 Query: 6 FKKYPPFMGISVKRINSSLDFFMNSLNWTRADISRNPTVVLYSFEKRVIPRISVLQILLS 185 F K+P M S K+I +D+++N + W + I+++P ++ S EKRVIPR SV+Q+LLS Sbjct: 330 FGKFPWVMMYSEKKIMKMMDYYINKMGWDSSSIAKHPLLISLSLEKRVIPRCSVIQVLLS 389 Query: 186 KGLISKTGIGQAIREAEDIFLKKYVTKHHHELPDLLTVYQNKV 314 KGL+ T + ++R +E++FL K+V + E P LL +YQ ++ Sbjct: 390 KGLVRLTSLATSLRISEELFLHKFVRPYKEEAPHLLKLYQEEL 432 >emb|CAN70295.1| hypothetical protein VITISV_035778 [Vitis vinifera] Length = 157 Score = 90.9 bits (224), Expect = 1e-16 Identities = 46/105 (43%), Positives = 66/105 (62%), Gaps = 1/105 (0%) Frame = +3 Query: 3 AFKKYPPFMGISVKRINSSLDFFMNSLNWTRADISRNPTVVLYSFEKRVIPRISVLQILL 182 AF++ P M +S K++N LDF +N + W A ++R P + +FEKRV+PR SV+++LL Sbjct: 45 AFRRRPQCMQLSEKKVNKVLDFLVNKMGWQPAVVARAPVAICLNFEKRVVPRCSVVKVLL 104 Query: 183 SKGLISK-TGIGQAIREAEDIFLKKYVTKHHHELPDLLTVYQNKV 314 KGLI K +G + FL KYV K+ ++P LL VYQ KV Sbjct: 105 LKGLIKKDLKLGTFLNLPVGDFLDKYVIKYEDDIPQLLDVYQGKV 149