BLASTX nr result
ID: Cimicifuga21_contig00026038
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00026038 (546 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD28627.2| RNA-directed DNA polymerase (Reverse transcriptas... 49 3e-06 >gb|ABD28627.2| RNA-directed DNA polymerase (Reverse transcriptase); Ribonuclease H [Medicago truncatula] Length = 1296 Score = 48.9 bits (115), Expect(2) = 3e-06 Identities = 37/106 (34%), Positives = 57/106 (53%), Gaps = 2/106 (1%) Frame = -1 Query: 474 SDVLLAECWAVWLGLQVFMFLGIHKVIVEVDSKALWSLLTRTDITLVPANIQGMITDIHH 295 +D+LLAE A+ GL + +GI ++ DS +L+TRT T +I DI Sbjct: 1179 TDILLAELTALHQGLIMAAEMGIEELACYSDSLLTINLITRT--TSKYHTYAVLIQDIKD 1236 Query: 294 MVQLCHPIVFHWTFREGNSVADGLAKW--ASNQAILIHMQLCPQVV 163 ++ + V+H FREGN AD LAK +SN+ L+H C +++ Sbjct: 1237 LLSAHNFSVYH-CFREGNQCADYLAKLGASSNEECLVHASACQELL 1281 Score = 26.9 bits (58), Expect(2) = 3e-06 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -2 Query: 545 AGAGGVFRNGDGGVIFGFA 489 AG GG+FRN GG + G++ Sbjct: 1154 AGFGGIFRNNVGGYLSGYS 1172