BLASTX nr result
ID: Cimicifuga21_contig00025960
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00025960 (448 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001042798.2| Os01g0293600 [Oryza sativa Japonica Group] g... 100 2e-19 ref|XP_003615596.1| Zinc finger MYM-type protein [Medicago trunc... 99 5e-19 ref|XP_003615119.1| Zinc finger MYM-type protein [Medicago trunc... 96 2e-18 ref|XP_003596572.1| Zinc finger MYM-type protein [Medicago trunc... 96 2e-18 ref|XP_003600945.1| HAT family dimerization domain containing pr... 94 9e-18 >ref|NP_001042798.2| Os01g0293600 [Oryza sativa Japonica Group] gi|255673136|dbj|BAF04712.2| Os01g0293600 [Oryza sativa Japonica Group] Length = 798 Score = 100 bits (248), Expect = 2e-19 Identities = 43/76 (56%), Positives = 58/76 (76%), Gaps = 1/76 (1%) Frame = -3 Query: 239 PALRKPISSYPPDEQDRIRRSYLLKGPCQPNHT-FPLTWFTDQNRGFQKSWYTRFGNWIE 63 P LRKPI +YPP+ +D+++R+Y L GP QPN T FP W + R FQK+W+ F +W+E Sbjct: 44 PGLRKPIEAYPPEIRDQVKRAYALSGPTQPNITIFPRKWQGGEWRSFQKTWFNEF-DWLE 102 Query: 62 YSISKDAAFCLYCYLF 15 YS+SKDAA+CLYCY+F Sbjct: 103 YSVSKDAAYCLYCYIF 118 >ref|XP_003615596.1| Zinc finger MYM-type protein [Medicago truncatula] gi|355516931|gb|AES98554.1| Zinc finger MYM-type protein [Medicago truncatula] Length = 892 Score = 98.6 bits (244), Expect = 5e-19 Identities = 45/79 (56%), Positives = 55/79 (69%), Gaps = 1/79 (1%) Frame = -3 Query: 239 PALRKPISSYPPDEQDRIRRSYLLKGPCQPN-HTFPLTWFTDQNRGFQKSWYTRFGNWIE 63 P R +S+Y P++Q+ IRR+YL KGPCQPN H FP + R F SW+ FGNW+E Sbjct: 145 PGKRPKMSTYHPNDQEIIRRAYLQKGPCQPNQHNFPQRKIGNSMRRFCPSWFNEFGNWLE 204 Query: 62 YSISKDAAFCLYCYLFKRD 6 YSI KDAAFCL CYLF+ D Sbjct: 205 YSIEKDAAFCLCCYLFRPD 223 >ref|XP_003615119.1| Zinc finger MYM-type protein [Medicago truncatula] gi|355516454|gb|AES98077.1| Zinc finger MYM-type protein [Medicago truncatula] Length = 787 Score = 96.3 bits (238), Expect = 2e-18 Identities = 45/78 (57%), Positives = 56/78 (71%), Gaps = 1/78 (1%) Frame = -3 Query: 239 PALRKPISSYPPDEQDRIRRSYLLKGPCQPN-HTFPLTWFTDQNRGFQKSWYTRFGNWIE 63 P LRK I Y PD QD++RR+Y+LKGP QPN +FP T F R F +SWY ++ WIE Sbjct: 43 PGLRKQIWEYAPDIQDQVRRAYILKGPTQPNLASFPRTQFGRDARSFSRSWYNKY-TWIE 101 Query: 62 YSISKDAAFCLYCYLFKR 9 YS SKDAA+C YC+LFK+ Sbjct: 102 YSESKDAAYCFYCFLFKQ 119 >ref|XP_003596572.1| Zinc finger MYM-type protein [Medicago truncatula] gi|355485620|gb|AES66823.1| Zinc finger MYM-type protein [Medicago truncatula] Length = 299 Score = 96.3 bits (238), Expect = 2e-18 Identities = 45/78 (57%), Positives = 56/78 (71%), Gaps = 1/78 (1%) Frame = -3 Query: 239 PALRKPISSYPPDEQDRIRRSYLLKGPCQPN-HTFPLTWFTDQNRGFQKSWYTRFGNWIE 63 P LRK I Y PD QD++RR+Y+LKGP QPN +FP T F R F +SWY ++ WIE Sbjct: 43 PGLRKQIWEYAPDIQDQVRRAYILKGPTQPNLASFPRTQFGRDARSFSRSWYNKY-TWIE 101 Query: 62 YSISKDAAFCLYCYLFKR 9 YS SKDAA+C YC+LFK+ Sbjct: 102 YSESKDAAYCFYCFLFKQ 119 >ref|XP_003600945.1| HAT family dimerization domain containing protein [Medicago truncatula] gi|355489993|gb|AES71196.1| HAT family dimerization domain containing protein [Medicago truncatula] Length = 835 Score = 94.4 bits (233), Expect = 9e-18 Identities = 44/78 (56%), Positives = 55/78 (70%), Gaps = 1/78 (1%) Frame = -3 Query: 239 PALRKPISSYPPDEQDRIRRSYLLKGPCQPN-HTFPLTWFTDQNRGFQKSWYTRFGNWIE 63 P RK I +Y PD QD++RR+Y+LKGP QPN +FP T F Q R F SWY ++ WIE Sbjct: 88 PGRRKQIHTYAPDIQDQVRRAYILKGPMQPNLSSFPRTLFGSQRRAFCSSWYKKY-TWIE 146 Query: 62 YSISKDAAFCLYCYLFKR 9 YS KDAA+C YC+LFK+ Sbjct: 147 YSEFKDAAYCFYCFLFKQ 164