BLASTX nr result
ID: Cimicifuga21_contig00025904
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00025904 (322 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_002802349.1| hypothetical protein CLM_0052 [Clostridium b... 50 1e-07 ref|ZP_02955128.1| conserved hypothetical protein [Clostridium b... 50 1e-07 ref|ZP_02955125.1| conserved hypothetical protein [Clostridium b... 50 1e-07 ref|ZP_04863280.1| conserved hypothetical protein [Clostridium b... 48 2e-07 ref|ZP_02863215.1| conserved hypothetical protein [Clostridium b... 48 2e-07 >ref|YP_002802349.1| hypothetical protein CLM_0052 [Clostridium botulinum A2 str. Kyoto] gi|226947261|ref|YP_002802352.1| hypothetical protein CLM_0059 [Clostridium botulinum A2 str. Kyoto] gi|226947265|ref|YP_002802356.1| hypothetical protein CLM_0067 [Clostridium botulinum A2 str. Kyoto] gi|226947271|ref|YP_002802362.1| hypothetical protein CLM_0079 [Clostridium botulinum A2 str. Kyoto] gi|226841062|gb|ACO83728.1| conserved hypothetical protein [Clostridium botulinum A2 str. Kyoto] gi|226842971|gb|ACO85637.1| conserved hypothetical protein [Clostridium botulinum A2 str. Kyoto] gi|226844394|gb|ACO87060.1| conserved hypothetical protein [Clostridium botulinum A2 str. Kyoto] gi|226844546|gb|ACO87212.1| conserved hypothetical protein [Clostridium botulinum A2 str. Kyoto] Length = 218 Score = 50.4 bits (119), Expect(2) = 1e-07 Identities = 23/38 (60%), Positives = 27/38 (71%) Frame = -1 Query: 322 VNSWGRPTCYL*SNCYPVSDGPSTRHCRITKIDFCLCS 209 V+SWGR CY + YP+SDGP TR+ RITK DF CS Sbjct: 15 VDSWGRSACYPRGSFYPLSDGPPTRYHRITKPDFRPCS 52 Score = 30.0 bits (66), Expect(2) = 1e-07 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -3 Query: 200 PFCLLC*RADSVRPEETFACLCYLLGG 120 PFCL RA S R E TF L Y LGG Sbjct: 61 PFCLCTLRAISDRAEGTFGRLRYFLGG 87 >ref|ZP_02955128.1| conserved hypothetical protein [Clostridium botulinum NCTC 2916] gi|226947650|ref|YP_002802741.1| hypothetical protein CLM_0490 [Clostridium botulinum A2 str. Kyoto] gi|226950969|ref|YP_002806060.1| hypothetical protein CLM_3990 [Clostridium botulinum A2 str. Kyoto] gi|226950971|ref|YP_002806062.1| hypothetical protein CLM_3999 [Clostridium botulinum A2 str. Kyoto] gi|182668006|gb|EDT79985.1| conserved hypothetical protein [Clostridium botulinum NCTC 2916] gi|226841315|gb|ACO83981.1| conserved hypothetical protein [Clostridium botulinum A2 str. Kyoto] gi|226842887|gb|ACO85553.1| conserved hypothetical protein [Clostridium botulinum A2 str. Kyoto] gi|226844092|gb|ACO86758.1| conserved hypothetical protein [Clostridium botulinum A2 str. Kyoto] Length = 218 Score = 50.4 bits (119), Expect(2) = 1e-07 Identities = 23/38 (60%), Positives = 27/38 (71%) Frame = -1 Query: 322 VNSWGRPTCYL*SNCYPVSDGPSTRHCRITKIDFCLCS 209 V+SWGR CY + YP+SDGP TR+ RITK DF CS Sbjct: 15 VDSWGRSACYPRGSFYPLSDGPPTRYHRITKPDFRPCS 52 Score = 30.0 bits (66), Expect(2) = 1e-07 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -3 Query: 200 PFCLLC*RADSVRPEETFACLCYLLGG 120 PFCL RA S R E TF L Y LGG Sbjct: 61 PFCLCTLRAISDRAEGTFGRLRYFLGG 87 >ref|ZP_02955125.1| conserved hypothetical protein [Clostridium botulinum NCTC 2916] gi|182668012|gb|EDT79991.1| conserved hypothetical protein [Clostridium botulinum NCTC 2916] Length = 184 Score = 50.4 bits (119), Expect(2) = 1e-07 Identities = 23/38 (60%), Positives = 27/38 (71%) Frame = -1 Query: 322 VNSWGRPTCYL*SNCYPVSDGPSTRHCRITKIDFCLCS 209 V+SWGR CY + YP+SDGP TR+ RITK DF CS Sbjct: 15 VDSWGRSACYPRGSFYPLSDGPPTRYHRITKPDFRPCS 52 Score = 30.0 bits (66), Expect(2) = 1e-07 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -3 Query: 200 PFCLLC*RADSVRPEETFACLCYLLGG 120 PFCL RA S R E TF L Y LGG Sbjct: 61 PFCLCTLRAISDRAEGTFGRLRYFLGG 87 >ref|ZP_04863280.1| conserved hypothetical protein [Clostridium botulinum D str. 1873] gi|253562195|gb|EES91647.1| conserved hypothetical protein [Clostridium botulinum D str. 1873] Length = 213 Score = 48.1 bits (113), Expect(2) = 2e-07 Identities = 22/38 (57%), Positives = 27/38 (71%) Frame = -1 Query: 322 VNSWGRPTCYL*SNCYPVSDGPSTRHCRITKIDFCLCS 209 V+SWGR CY + YP+SDGPS ++ RITK DF CS Sbjct: 15 VDSWGRSACYPRGSFYPLSDGPSIQNHRITKPDFRPCS 52 Score = 31.6 bits (70), Expect(2) = 2e-07 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -3 Query: 200 PFCLLC*RADSVRPEETFACLCYLLGG 120 PFCL RA S R E TF L YLLGG Sbjct: 61 PFCLCTLRAISDRAEGTFGRLRYLLGG 87 >ref|ZP_02863215.1| conserved hypothetical protein [Clostridium botulinum C str. Eklund] gi|169338126|ref|ZP_02863226.1| conserved hypothetical protein [Clostridium botulinum C str. Eklund] gi|169338132|ref|ZP_02863230.1| conserved hypothetical protein [Clostridium botulinum C str. Eklund] gi|118135266|gb|ABK62310.1| conserved hypothetical protein [Clostridium novyi NT] gi|118135598|gb|ABK62642.1| conserved hypothetical protein [Clostridium novyi NT] gi|169294009|gb|EDS76142.1| conserved hypothetical protein [Clostridium botulinum C str. Eklund] gi|169294037|gb|EDS76170.1| conserved hypothetical protein [Clostridium botulinum C str. Eklund] gi|169294149|gb|EDS76282.1| conserved hypothetical protein [Clostridium botulinum C str. Eklund] Length = 213 Score = 48.1 bits (113), Expect(2) = 2e-07 Identities = 22/38 (57%), Positives = 27/38 (71%) Frame = -1 Query: 322 VNSWGRPTCYL*SNCYPVSDGPSTRHCRITKIDFCLCS 209 V+SWGR CY + YP+SDGPS ++ RITK DF CS Sbjct: 15 VDSWGRSACYPRGSFYPLSDGPSIQNHRITKPDFRPCS 52 Score = 31.6 bits (70), Expect(2) = 2e-07 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -3 Query: 200 PFCLLC*RADSVRPEETFACLCYLLGG 120 PFCL RA S R E TF L YLLGG Sbjct: 61 PFCLCTLRAISDRAEGTFGRLRYLLGG 87