BLASTX nr result
ID: Cimicifuga21_contig00024925
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00024925 (428 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002338214.1| predicted protein [Populus trichocarpa] gi|2... 102 1e-24 ref|YP_398917.1| hypothetical protein NitoCp121 [Nicotiana tomen... 110 2e-22 ref|YP_001109552.1| hypothetical protein Poptr_cp074 [Populus tr... 108 3e-22 ref|XP_002319333.1| predicted protein [Populus trichocarpa] gi|2... 107 1e-21 ref|NP_054982.1| hypothetical protein SpolCp149 [Spinacia olerac... 103 1e-20 >ref|XP_002338214.1| predicted protein [Populus trichocarpa] gi|222871287|gb|EEF08418.1| predicted protein [Populus trichocarpa] Length = 81 Score = 102 bits (255), Expect(2) = 1e-24 Identities = 54/66 (81%), Positives = 57/66 (86%) Frame = +2 Query: 98 GAGLKKDPRVSRVGPGGSLNAFFFLLIGVIS*RLAMARKKGGTSTLGERSTTESCMLCLR 277 G+ LKKD RVS+VGPGGSLNAFFFLLIGVIS RLAM RKKGGTSTLGERST ESCML Sbjct: 12 GSRLKKDLRVSKVGPGGSLNAFFFLLIGVISKRLAMVRKKGGTSTLGERSTPESCMLRSG 71 Query: 278 RMNQIR 295 RMN+ R Sbjct: 72 RMNRSR 77 Score = 35.4 bits (80), Expect(2) = 1e-24 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 64 MCLFIYLLTRNGSRFEK 114 MCLFIYLLTRNGSR +K Sbjct: 1 MCLFIYLLTRNGSRLKK 17 >ref|YP_398917.1| hypothetical protein NitoCp121 [Nicotiana tomentosiformis] gi|81301638|ref|YP_398933.1| hypothetical protein NitoCp122 [Nicotiana tomentosiformis] gi|351653934|ref|YP_004891660.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|351653949|ref|YP_004891676.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|76559646|emb|CAJ32484.1| hypothetical protein [Nicotiana tabacum] gi|76559648|emb|CAJ32486.1| hypothetical protein [Nicotiana tabacum] gi|77799619|dbj|BAE46708.1| hypothetical protein [Nicotiana sylvestris] gi|77799635|dbj|BAE46724.1| hypothetical protein [Nicotiana sylvestris] gi|80750981|dbj|BAE48057.1| hypothetical protein [Nicotiana tomentosiformis] gi|80750997|dbj|BAE48073.1| hypothetical protein [Nicotiana tomentosiformis] gi|347453960|gb|AEO95618.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347453975|gb|AEO95633.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347454070|gb|AEO95727.1| hypothetical protein [synthetic construct] gi|347454085|gb|AEO95742.1| hypothetical protein [synthetic construct] Length = 71 Score = 110 bits (274), Expect = 2e-22 Identities = 58/67 (86%), Positives = 59/67 (88%) Frame = +2 Query: 95 MGAGLKKDPRVSRVGPGGSLNAFFFLLIGVIS*RLAMARKKGGTSTLGERSTTESCMLCL 274 MGAGLKKD RVSRVGPGGSLNAFFFLLIGVIS RLA RKKGGTSTLGERSTTESCML Sbjct: 1 MGAGLKKDLRVSRVGPGGSLNAFFFLLIGVISQRLARVRKKGGTSTLGERSTTESCMLRS 60 Query: 275 RRMNQIR 295 RMN+ R Sbjct: 61 GRMNRSR 67 >ref|YP_001109552.1| hypothetical protein Poptr_cp074 [Populus trichocarpa] gi|134093266|ref|YP_001109567.1| hypothetical protein Poptr_cp089 [Populus trichocarpa] gi|133712113|gb|ABO36756.1| conserved hypothetical protein [Populus trichocarpa] gi|133712128|gb|ABO36771.1| conserved hypothetical protein [Populus trichocarpa] Length = 71 Score = 108 bits (271), Expect = 3e-22 Identities = 57/67 (85%), Positives = 59/67 (88%) Frame = +2 Query: 95 MGAGLKKDPRVSRVGPGGSLNAFFFLLIGVIS*RLAMARKKGGTSTLGERSTTESCMLCL 274 MGAGLKKD RVS+VGPGGSLNAFFFLLIGVIS RLAM RKKGGTSTLGERST ESCML Sbjct: 1 MGAGLKKDLRVSKVGPGGSLNAFFFLLIGVISKRLAMVRKKGGTSTLGERSTPESCMLRS 60 Query: 275 RRMNQIR 295 RMN+ R Sbjct: 61 GRMNRSR 67 >ref|XP_002319333.1| predicted protein [Populus trichocarpa] gi|222857709|gb|EEE95256.1| predicted protein [Populus trichocarpa] Length = 71 Score = 107 bits (267), Expect = 1e-21 Identities = 56/67 (83%), Positives = 58/67 (86%) Frame = +2 Query: 95 MGAGLKKDPRVSRVGPGGSLNAFFFLLIGVIS*RLAMARKKGGTSTLGERSTTESCMLCL 274 MGAGLKKD RVS+VGPGGSLNAFFFLLIGVIS RL M RKKGGTSTLGERST ESCML Sbjct: 1 MGAGLKKDLRVSKVGPGGSLNAFFFLLIGVISKRLVMVRKKGGTSTLGERSTPESCMLRS 60 Query: 275 RRMNQIR 295 RMN+ R Sbjct: 61 GRMNRSR 67 >ref|NP_054982.1| hypothetical protein SpolCp149 [Spinacia oleracea] gi|11497590|ref|NP_054997.1| hypothetical protein SpolCp150 [Spinacia oleracea] gi|7636156|emb|CAB88778.1| hypothetical protein [Spinacia oleracea] gi|7636171|emb|CAB88793.1| hypothetical protein [Spinacia oleracea] Length = 72 Score = 103 bits (257), Expect = 1e-20 Identities = 57/66 (86%), Positives = 58/66 (87%), Gaps = 1/66 (1%) Frame = +2 Query: 95 MGAGLKKDPRVSRVGPGGSLNAFFFLLIGVIS*RLAMA-RKKGGTSTLGERSTTESCMLC 271 MGAGLKKD RVSRVGPGGSLNAFFFLLIGVIS RLAM KKGGTSTLGERSTTESCML Sbjct: 1 MGAGLKKDLRVSRVGPGGSLNAFFFLLIGVISQRLAMVIWKKGGTSTLGERSTTESCMLR 60 Query: 272 LRRMNQ 289 RMN+ Sbjct: 61 SGRMNR 66