BLASTX nr result
ID: Cimicifuga21_contig00024739
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00024739 (266 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517018.1| ankyrin repeat-containing protein, putative ... 56 3e-06 >ref|XP_002517018.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223543653|gb|EEF45181.1| ankyrin repeat-containing protein, putative [Ricinus communis] Length = 582 Score = 55.8 bits (133), Expect = 3e-06 Identities = 30/72 (41%), Positives = 43/72 (59%) Frame = -1 Query: 263 DDNSSAVKIRKLVLEKLPSQSKLRMGELRWTSLHYAACGGDVSAVQDIITFCPDCTELED 84 D N A I + +LE S + + + + T+LH AAC G+V +++II+ CPDC E+ D Sbjct: 280 DQNFGAYVIVQRLLECDKSAAYVVDKDRKRTALHLAACRGNVRIMKEIISKCPDCCEIAD 339 Query: 83 QRGQNFLHLAAV 48 RG N LH A V Sbjct: 340 DRGWNVLHYAVV 351