BLASTX nr result
ID: Cimicifuga21_contig00024556
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00024556 (236 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW81345.1| hypothetical protein ZEAMMB73_015937 [Zea mays] 64 2e-08 ref|XP_003728713.1| PREDICTED: spliceosome RNA helicase DDX39B-l... 63 2e-08 ref|XP_003604423.1| ATP-dependent RNA helicase SUB2-2 [Medicago ... 63 2e-08 ref|XP_002517621.1| hypothetical protein RCOM_0899280 [Ricinus c... 63 3e-08 emb|CAN76234.1| hypothetical protein VITISV_030204 [Vitis vinifera] 62 4e-08 >gb|AFW81345.1| hypothetical protein ZEAMMB73_015937 [Zea mays] Length = 110 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -2 Query: 235 HSSGFRDFLLKPELLRAIVDSGFEHPSEGNTLLLY 131 HSSGFRDFLLKPELLRAI D GFEHPSEG L +Y Sbjct: 46 HSSGFRDFLLKPELLRAIQDCGFEHPSEGKLLFIY 80 >ref|XP_003728713.1| PREDICTED: spliceosome RNA helicase DDX39B-like [Strongylocentrotus purpuratus] Length = 80 Score = 63.2 bits (152), Expect = 2e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 235 HSSGFRDFLLKPELLRAIVDSGFEHPSEGNTL 140 HSSGFRDFLLKPELLRAIVD GFEHPSEG +L Sbjct: 45 HSSGFRDFLLKPELLRAIVDCGFEHPSEGKSL 76 >ref|XP_003604423.1| ATP-dependent RNA helicase SUB2-2 [Medicago truncatula] gi|355505478|gb|AES86620.1| ATP-dependent RNA helicase SUB2-2 [Medicago truncatula] Length = 63 Score = 63.2 bits (152), Expect = 2e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -2 Query: 235 HSSGFRDFLLKPELLRAIVDSGFEHPSEG 149 HSSGFRDFLLKPELLRAIVDSGFEHPSEG Sbjct: 23 HSSGFRDFLLKPELLRAIVDSGFEHPSEG 51 >ref|XP_002517621.1| hypothetical protein RCOM_0899280 [Ricinus communis] gi|223543253|gb|EEF44785.1| hypothetical protein RCOM_0899280 [Ricinus communis] Length = 149 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -2 Query: 235 HSSGFRDFLLKPELLRAIVDSGFEHPSEG 149 HSSGFRDFLLKPELLRAI+DSGFEHPSEG Sbjct: 49 HSSGFRDFLLKPELLRAIIDSGFEHPSEG 77 >emb|CAN76234.1| hypothetical protein VITISV_030204 [Vitis vinifera] Length = 383 Score = 62.4 bits (150), Expect = 4e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -2 Query: 235 HSSGFRDFLLKPELLRAIVDSGFEHPSEGNTL 140 HSSGFRDFLLKPELLR+IVDSGFEHPSEG + Sbjct: 45 HSSGFRDFLLKPELLRSIVDSGFEHPSEGKCI 76