BLASTX nr result
ID: Cimicifuga21_contig00024190
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00024190 (310 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_190408.1| pentatricopeptide repeat-containing protein [Ar... 155 2e-36 ref|XP_002877605.1| pentatricopeptide repeat-containing protein ... 155 4e-36 ref|XP_004138087.1| PREDICTED: pentatricopeptide repeat-containi... 152 3e-35 ref|XP_003550712.1| PREDICTED: pentatricopeptide repeat-containi... 150 8e-35 ref|XP_002511313.1| pentatricopeptide repeat-containing protein,... 149 2e-34 >ref|NP_190408.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75207690|sp|Q9STK5.1|PP269_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g48250, chloroplastic; Flags: Precursor gi|4678363|emb|CAB41173.1| putative protein [Arabidopsis thaliana] gi|332644870|gb|AEE78391.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 621 Score = 155 bits (393), Expect = 2e-36 Identities = 76/103 (73%), Positives = 83/103 (80%) Frame = +2 Query: 2 YELMMDSPYKPPIANCSSLLHHISLSNTPDLDLVSRVFKKYESTGNTLSKAVYDGVHRSL 181 YE MMD P+KP I +CS LL ++S S PDLDLV RV +KYESTG +LSKAVYDG+HRSL Sbjct: 321 YEYMMDGPFKPSIQDCSLLLRYLSGSPNPDLDLVFRVSRKYESTGKSLSKAVYDGIHRSL 380 Query: 182 TGVGRFDEAENILDTMRNTGYEPDNITYSQLVFGLCKVGRLEE 310 T VGRFDEAE I MRN GYEPDNITYSQLVFGLCK RLEE Sbjct: 381 TSVGRFDEAEEITKAMRNAGYEPDNITYSQLVFGLCKAKRLEE 423 >ref|XP_002877605.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297323443|gb|EFH53864.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 618 Score = 155 bits (391), Expect = 4e-36 Identities = 75/103 (72%), Positives = 82/103 (79%) Frame = +2 Query: 2 YELMMDSPYKPPIANCSSLLHHISLSNTPDLDLVSRVFKKYESTGNTLSKAVYDGVHRSL 181 YE MMD P+KP I +CS LL ++S PDLDLV RV +KYESTG +LSKAVYDG+HRSL Sbjct: 318 YEYMMDGPFKPSIQDCSLLLRYLSARPNPDLDLVFRVSRKYESTGKSLSKAVYDGIHRSL 377 Query: 182 TGVGRFDEAENILDTMRNTGYEPDNITYSQLVFGLCKVGRLEE 310 T VGRFDEAE I MRN GYEPDNITYSQLVFGLCK RLEE Sbjct: 378 TSVGRFDEAEEITKAMRNAGYEPDNITYSQLVFGLCKAKRLEE 420 >ref|XP_004138087.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Cucumis sativus] gi|449524136|ref|XP_004169079.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Cucumis sativus] Length = 632 Score = 152 bits (384), Expect = 3e-35 Identities = 71/103 (68%), Positives = 85/103 (82%) Frame = +2 Query: 2 YELMMDSPYKPPIANCSSLLHHISLSNTPDLDLVSRVFKKYESTGNTLSKAVYDGVHRSL 181 YELMMD PYKP + +CS LL I+ S+ PDL LV RV KK+E+TG +LSKA+YDG+HRSL Sbjct: 316 YELMMDGPYKPSLQDCSVLLRTIAASDNPDLSLVYRVAKKFEATGYSLSKAMYDGIHRSL 375 Query: 182 TGVGRFDEAENILDTMRNTGYEPDNITYSQLVFGLCKVGRLEE 310 T G+FD+AENI+ +MRN GYEPDN+TYSQLVFGLCK RLEE Sbjct: 376 TSTGKFDDAENIVKSMRNAGYEPDNVTYSQLVFGLCKARRLEE 418 >ref|XP_003550712.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Glycine max] Length = 635 Score = 150 bits (380), Expect = 8e-35 Identities = 72/103 (69%), Positives = 84/103 (81%) Frame = +2 Query: 2 YELMMDSPYKPPIANCSSLLHHISLSNTPDLDLVSRVFKKYESTGNTLSKAVYDGVHRSL 181 YELMMD KP + +C+ LL IS ++ P+LDLV RV KKYESTG+TLSKA+YDG+HRSL Sbjct: 322 YELMMDGSCKPLVQDCNMLLKSISANDKPNLDLVFRVAKKYESTGHTLSKAIYDGIHRSL 381 Query: 182 TGVGRFDEAENILDTMRNTGYEPDNITYSQLVFGLCKVGRLEE 310 T G FDEAENI+ TMRN GYEPDNITYSQ+VFGLCK+ R EE Sbjct: 382 TSAGNFDEAENIVRTMRNAGYEPDNITYSQMVFGLCKMRRFEE 424 >ref|XP_002511313.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550428|gb|EEF51915.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 627 Score = 149 bits (376), Expect = 2e-34 Identities = 70/103 (67%), Positives = 81/103 (78%) Frame = +2 Query: 2 YELMMDSPYKPPIANCSSLLHHISLSNTPDLDLVSRVFKKYESTGNTLSKAVYDGVHRSL 181 YE MMD P+KP + +CS LL IS SN PDL+LV RV KYE+TGN+LSKAVYDG+HRSL Sbjct: 321 YEFMMDGPFKPSVQDCSMLLRSISASNYPDLNLVFRVVNKYEATGNSLSKAVYDGIHRSL 380 Query: 182 TGVGRFDEAENILDTMRNTGYEPDNITYSQLVFGLCKVGRLEE 310 T +G FDEA ++ M+ GYEPDNITYSQLVFGLCK RLEE Sbjct: 381 TSIGNFDEAAKMMKCMQTAGYEPDNITYSQLVFGLCKARRLEE 423