BLASTX nr result
ID: Cimicifuga21_contig00023486
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00023486 (504 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAA84682.1| unknown protein (chloroplast) [Nicotiana tabacum]... 48 1e-06 >gb|AAA84682.1| unknown protein (chloroplast) [Nicotiana tabacum] gi|224352|prf||1102209F ORF 6 Length = 79 Score = 47.8 bits (112), Expect(3) = 1e-06 Identities = 23/36 (63%), Positives = 27/36 (75%) Frame = +2 Query: 8 INLKNYMISSRTKHESFGSFGSHAHLLMGHSHISFF 115 I +N +I SRTKHESF SFGSHA LL +SHI F+ Sbjct: 8 IPFQNSIIPSRTKHESFDSFGSHAQLLKVNSHIFFY 43 Score = 26.6 bits (57), Expect(3) = 1e-06 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = +3 Query: 180 PEYSEDSSDQTKNL 221 P+YSEDSSD+ KN+ Sbjct: 66 PKYSEDSSDKIKNM 79 Score = 22.3 bits (46), Expect(3) = 1e-06 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 109 FFLCNELILSSLLGFQ 156 F+ CNE I SSL FQ Sbjct: 42 FYECNEPIFSSLFIFQ 57