BLASTX nr result
ID: Cimicifuga21_contig00023169
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00023169 (376 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAK70406.1|AF369930_1 pol polyprotein [Citrus x paradisi] 80 2e-13 gb|ABG37666.1| CCHC-type integrase [Populus trichocarpa] 75 6e-12 gb|ABO26299.1| polyprotein [Nicotiana tabacum] 72 4e-11 emb|CAL69016.1| pol domain [Agave tequilana] 71 1e-10 emb|CAN80304.1| hypothetical protein VITISV_017821 [Vitis vinifera] 69 5e-10 >gb|AAK70406.1|AF369930_1 pol polyprotein [Citrus x paradisi] Length = 297 Score = 80.1 bits (196), Expect = 2e-13 Identities = 37/56 (66%), Positives = 45/56 (80%) Frame = +1 Query: 1 RMKHIDVHYHFVRDVIEDSDISLLKVGTKDNPADMLMKVVTGVKFQDCLGLLQILR 168 R KHIDV YH+VR++IE D+ L K+ TKDNP+DML KVV+ VKFQ CL L+QILR Sbjct: 240 RTKHIDVKYHYVREIIEGGDVLLKKIDTKDNPSDMLTKVVSEVKFQHCLKLIQILR 295 >gb|ABG37666.1| CCHC-type integrase [Populus trichocarpa] Length = 353 Score = 75.1 bits (183), Expect = 6e-12 Identities = 32/51 (62%), Positives = 41/51 (80%) Frame = +1 Query: 1 RMKHIDVHYHFVRDVIEDSDISLLKVGTKDNPADMLMKVVTGVKFQDCLGL 153 R KHIDV +HFVR+++++ DI L K+GT DNPADML K V+G+KFQ CL L Sbjct: 48 RTKHIDVRFHFVREIVDEGDILLQKIGTADNPADMLTKCVSGIKFQHCLDL 98 >gb|ABO26299.1| polyprotein [Nicotiana tabacum] Length = 57 Score = 72.4 bits (176), Expect = 4e-11 Identities = 32/55 (58%), Positives = 42/55 (76%) Frame = +1 Query: 1 RMKHIDVHYHFVRDVIEDSDISLLKVGTKDNPADMLMKVVTGVKFQDCLGLLQIL 165 R KHIDV YHFVR++IE+ +++ K+ T +NPADML KVV VKFQ CL L+ I+ Sbjct: 1 RTKHIDVRYHFVREIIEEGGVTVKKIHTTENPADMLTKVVIAVKFQHCLDLINIV 55 >emb|CAL69016.1| pol domain [Agave tequilana] Length = 52 Score = 70.9 bits (172), Expect = 1e-10 Identities = 32/50 (64%), Positives = 41/50 (82%) Frame = +1 Query: 19 VHYHFVRDVIEDSDISLLKVGTKDNPADMLMKVVTGVKFQDCLGLLQILR 168 V YHFVR+++E+ DI+LLK+ T +NPADML KVV+GVKF C LLQIL+ Sbjct: 1 VRYHFVREILEEDDINLLKIHTSENPADMLTKVVSGVKFAHCKDLLQILQ 50 >emb|CAN80304.1| hypothetical protein VITISV_017821 [Vitis vinifera] Length = 939 Score = 68.6 bits (166), Expect = 5e-10 Identities = 28/54 (51%), Positives = 40/54 (74%) Frame = +1 Query: 1 RMKHIDVHYHFVRDVIEDSDISLLKVGTKDNPADMLMKVVTGVKFQDCLGLLQI 162 R KHIDV +HF+RD+ E +++ K+ TKDNPADML K ++ VKF+ CL L+ + Sbjct: 883 RTKHIDVRFHFIRDIAEQGLVNVSKISTKDNPADMLTKPISKVKFKQCLNLINV 936